Search Results

Search found 6622 results on 265 pages for 'match'.

Page 6/265 | < Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >

  • How can I match a twitter username with angular ui router

    - by user3929999
    I need to be able to match a path like '/@someusername' with angular ui router but can't figure out the regex for it. What I have are routes like the following $stateProvider .state('home', {url:'/', templateUrl:'/template/path.html'}) .state('author', {url:'/{username:[regex-to-match-@username-here]}'}) .state('info', {url:'/:slug', templateUrl:'/template/path.html'}) .state('entry', {url:'/:type/:slug', templateUrl:'/template/path.html'}); I need a bit of regex for the 'author' route that will match @usernames. Currently, everything I try is caught by the 'entry' route.

    Read the article

  • MongoDb - $match filter not working in subdocument

    - by Ranjith
    This is Collection Structure [{ "_id" : "....", "name" : "aaaa", "level_max_leaves" : [ { level : "ObjectIdString 1", max_leaves : 4, } ] }, { "_id" : "....", "name" : "bbbb", "level_max_leaves" : [ { level : "ObjectIdString 2", max_leaves : 2, } ] }] I need to find the subdocument value of level_max_leaves.level filter when its matching with given input value. And this how I tried, For example, var empLevelId = 'ObjectIdString 1' ; MyModel.aggregate( {$unwind: "$level_max_leaves"}, {$match: {"$level_max_leaves.level": empLevelId } }, {$group: { "_id": "$level_max_leaves.level", "total": { "$sum": "$level_max_leaves.max_leaves" }}}, function (err, res) { console.log(res); }); But here the $match filter is not working. I can't find out exact results of ObjectIdString 1 If I filter with name field, its working fine. like this, {$match: {"$name": "aaaa" } }, But in subdocument level its returns 0. {$match: {"$level_max_leaves.level": "ObjectIdString 1"} }, My expected result was, { "_id" : "ObjectIdString 1", "total" : 4, }

    Read the article

  • Find last match with python regular expression

    - by SDD
    I wanto to match the last occurence of a simple pattern in a string, e.g. list = re.findall(r"\w+ AAAA \w+", "foo bar AAAA foo2 AAAA bar2) print "last match: ", list[len(list)-1] however, if the string is very long, a huge list of matches is generated. Is there a more direct way to match the second occurence of "AAAA" or should I use this workaround?

    Read the article

  • Match Anything Except a Sub-pattern

    - by Tim Lytle
    I'd like to accomplish what this (invalid I believe) regular expression tries to do: <p><a>([^(<\/a>)]+?)<\/a></p>uniquestring Essentially match anything except a closing anchor tag. Simple non-greedy doesn't help here because `uniquestring' may very well be after another distant closing anchor tag: <p><a>text I don't <tag>want</tag> to match</a></p>random data<p><a>text I do <tag>want to</tag> match</a></p>uniquestring more matches <p><a>of <tag>text I do</tag> want to match</a></p>uniquestring So I have more tag in between the anchor tags. And I'm using the presence of uniquestring to determine if I want to match the data. So a simple non-greedy ends up matching everything from the start of the data I don't want to the end of the data I do want. I know I'm edging close to the problems regular expressions (or at least my knowledge of them) aren't good at solving. I could just through the data at an HTML/XML parser, but it is just one simple(ish) search. Is there some easy way to do this that I'm just missing?

    Read the article

  • RegEx - character not before match

    - by danneth
    I understand the consepts of RegEx, but this is more or less the first time I've actually been trying to write some myself. As a part of a project, I'm attempting to parse out strings which match to a certain domain (actually an array of domains, but let's keep it simple). At first I started out with this: url.match('www.example.com') But I noticed I was also getting input like this: http://www.someothersite.com/page?ref=http://www.example.com These rows will ofcourse match for www.example.com but I wish to exclude them. So I was thinking along these lines: Only match rows that contain www.example.com, but not after a ? character. This is what I came up with: var reg = new RegExp("[^\\?]*" + url + "(\\.*)", "gi"); This does however not seem to work, any suggestions would be greatly appreciated as I fear I've used what little knowledge I yet possess in the matter.

    Read the article

  • Regex: Match any character (including whitespace) except a comma

    - by selecsosi
    I would like to match any character and any whitespace except comma with regex. Only matching any character except comma gives me: [^,]* but I also want to match any whitespace characters, tabs, space, newline, etc. anywhere in the string. For example, I would like to be able to match all of this up until the comma: "bla bla bla" "asdfasdfasdfasdfasdfasdf" "asdfasdfasdf", Is there a simple way to do this without knowing where the whitespace may be?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • efficientcy effort: grep with a vectored pattern or match with a list of values

    - by Elad663
    I guess this is trivial, I apologize, I couldn't find how to do it. I am trying to abstain from a loop, so I am trying to vectorize the process: I need to do something like grep, but where the pattern is a vector. Another option is a match, where the value is not only the first location. For example data (which is not how the real data is, otherswise I would exploit it structure): COUNTRIES=c("Austria","Belgium","Denmark","France","Germany", "Ireland","Italy","Luxembourg","Netherlands", "Portugal","Sweden","Spain","Finland","United Kingdom") COUNTRIES_Target=rep(COUNTRIES,times=4066) COUNTRIES_Origin=rep(COUNTRIES,each=4066) Now, currently I got a loop that: var_pointer=list() for (i in 1:length(COUNTRIES_Origin)) { var_pointer[[i]]=which(COUNTRIES_Origin[i]==COUNTRS_Target) } The problem with match is that match(x=COUNTRIES_Origin,table=COUNTRIES_Target) returns a vector of the same length as COUNTRIES_Origin and the value is the first match, while I need all of them. The issue with grep is that grep(pattern=COUNTRIES_Origin,x=COUNTRIES_Target) is the given warning: Warning message: In grep(pattern = COUNTRIES_Origin, x = COUNTRIES_Target) : argument 'pattern' has length > 1 and only the first element will be used Any suggestions?

    Read the article

  • iTunes Keeps Crashing After Activating iTunes Match

    - by David
    This morning I activated iTunes Match. There were over 20,000 songs to scan and upload, so I walked away and came back to it this afternoon. Upon returning, I found that iTunes had crashed. Now any time I try to open iTunes, the window displays but within a second (seemingly as soon as it tries to access iTunes Match, but I have no way of confirming that) it crashes. So I effectively can't get iTunes to run. Has this happened for anybody else? Does anybody have any suggestions for fixing or even diagnosing this?

    Read the article

  • OpenBSD pf 'match in all scrub (no-df)' causes HTTPS to be unreachable on mobile network

    - by Frank ter V.
    First of all: excuse me for my poor usage of the English language. For several years I'm experiencing problems with the 'match in all scrub (no-df)' rule in pf. I can't find out what's happening here. I'll try to be clear and simple. The pf.conf has been extremely shortened for this forum posting. Here is my pf.conf: set skip on lo0 match in all scrub (no-df) block all block in quick from urpf-failed pass in on em0 proto tcp from any to 213.125.xxx.xxx port 80 synproxy state pass in on em0 proto tcp from any to 213.125.xxx.xxx port 443 synproxy state pass out on em0 from 213.125.xxx.xxx to any modulate state HTTP and HTTPS are working fine. Until the moment a customer in France (Wanadoo DSL) couldn't view HTTPS pages! I blamed his provider and did no investigation on that problem. But then... I bought an Android Samsung Galaxy SII (Vodafone) to monitor my servers. Hours after I walked out of the telephone store: no HTTPS-connections on my server! I thought my servers were down, drove back to the office very fast. But they were up. I discovered that disabling the rule match in all scrub (no-df) solves the problem. Android phone (Vodafone NL) and Wanadoo DSL FR are now OK on HTTPS. But now I don't have any scrubbing anymore. This is not what I want. Does anyone here understand what is going on? I don't. Enabling scrubbing causes HTTPS webpages not to be loaded on SOME ISP's, but not all. In systat, I strangely DO see a state created and packets received from those ISP's... Still confused. I'm using OpenBSD 5.1/amd64 and OpenBSD 5.0/i386. I have two ISP's at my office (one DSL and one cable). Affects both. This can be reproduced quite easily. I hope someone has experience with this problem. Greetings, Frank

    Read the article

  • Installing mysql-devel to match MySQL version

    - by markxi
    I'm running MySQL 5.1.52 on CentOS 4.6 and I'm trying to install mysql-devel to match my MySQL version. If I do yum install mysql-devel it wants to upgrade MySQL to 5.1.58, yet if I do yum search mysql-devel, in addition to finding 5.1.58, I get a match for: 5.1.52-jason.1 .. utterramblings .. Matched from: mysql-devel Why is yum trying to install an updated version and is there any way to get it to install the correct version without the need to upgrade MySQL? I'd appreciate any help.

    Read the article

  • Windows 8.1 Search does not automatically select first search match

    - by Miguel Sevilla
    When I search in Windows 8/8.1 (start menu-start typing), it doesn't automatically highlight the search term. For example, if I'm trying to open the "Internet Options" panel and type the entire thing out in search, I have to down arrow or tab to the "Internet Options" search result. This is retarded. I'm used to Windows 7 style search where the first match is highlighted and i can easily just hit return. First match highlighting does work for other built-in things like "Control Panel", but it should work for all things in general, as it did in Windows 7 search. Anyways, if there is an option to enable this in Windows 8/8.1, I'd appreciate the tip. Thanks!

    Read the article

  • Word is ignoring my 'Match Destination Formatting' preference when pasting text

    - by CreeDorofl
    I'm stuck using word 2007 at the office. It has options for retaining formatting, pasting as plain text, and pasting text to match the destination's formatting. That last option is the one I want, but word is blatantly ignoring it. I copy some text from a PDF, paste into word, and it retains the PDF's formatting... even though I went into options -- advanced -- changed all the dropdowns to "Match Destination Formatting". It also ignores "text only" option... It retains the exact mix of bold, italic, normal text & fonts. I can work around it by pasting to a plain text file, then pasting into word. Or I can do paste special -- unformatted text. But this is so irritating... I just want to ctrl+V and not hassle with it every single time. Is there a better fix?

    Read the article

  • Match exactly (and only) the pattern I specify in a grep command

    - by palswim
    Usually, grep searches for all lines containing a match for the pattern/parameter I specify. I would like to match just the pattern (i.e. not the whole line). So, if a file contains the lines: We said that we'll come. Unfortunately, we were delayed. Now, we're on our way. I want to find all contractions starting with "we" (regex pattern: we\'[a-z]+/i). And I'm looking for the output: we'll we're How do I do this (with grep or another Unix/Windows command-line tool)?

    Read the article

  • VIM autocompletion: Making ^X^U expand to longest match

    - by Sarah
    I'm using eclim to bring some eclipse functionality to VIM, however the code completion functions seem to work less than ideal. When I press ctrl+x ctrl+u after, for instance, System.out. with the curser right after the last dot, I get the completion popup-menu. This menu is really rather cumbersome to use, and the functionality that I would ideally want is something like: ctrl+x ctrl+u (expands to longest match) fill in more characters (expand to longest match). Is this possible somehow? I've tried fiddling with the completeopts settings, but they don't seem to do what I want.

    Read the article

  • Nginx location to match query parameters

    - by Dave
    Is it possible in nginx to have a location {} block that matches query parameters. For example I want to pick up that "preview=true" in this url and then instruct it to do several different things, all possible in a location block. http://192.158.0.1/web/test.php?hello=test&preview=true&another=var The problem I'm having is that my test stuff doesn't seem to match, it seems like I can only match the URL itself? E.g. location ~ ^(.*)(preview)(.*)$ Or something aloong those lines?

    Read the article

  • match patterns update output file uncomment when desired

    - by user2692634
    Need suggestion for following. Have two files myfile and responsefile. First file myfile.txt user=myname user_1=yourname group=mygroup group_1=yourgroup second file responsefile.txt #Please fill details user= #user_1= #user_2= #Please fill details group= #group_1= #group_2= Based on myfile.txt data update responsefile.txt as below and the file responsefile.txt is lenghty of about 604L, 16481C. Result output responsefile.txt #Please fill details user=myname user_1=yourname #user_2= #Please fill details group=mygroup group_1=yourgroup #group_2= If you observe myfile above, I want to match user= in responsefile, then update as user=myname, same applies for group=. Then match user_1= and group_1= which is hashed or commented in responsefile, update as user_1=yourname and group_1=yourgroup. Should not remove hash or uncomment for others in file. I tried this awk -F= 'NR==FNR{a[$1]=$0;next}$1 in a{$0=a[$1]}1' myfile.txt responsefile.txt Please suggest thanks in advance.

    Read the article

  • API numbers don't match on compiled PHP extension

    - by tixrus
    I'm trying to get GD into my PHP. I recently installed PHP5.3.0 on my system running Mac Leopard using mac ports. It did not come with the gd module. So I downloaded gd, compiled it as an extension module as per http://www.kenior.ch/macintosh/adding-gd-library-for-mac-os-x-leopard, made php.ini point to it, restarted apache etc. But no GD. So in apache error log it says PHP Warning: PHP Startup: gd: Unable to initialize module\nModule compiled with module API=20060613\nPHP compiled with module API=20090115\nThese options need to match\n in Unknown on line 0 So a bit of googling says I should not use the phpize I have before configuring and making these. I should use a new one called phpize5. I surely don't have any such thing. Unless its packed up inside something else in my php5.3. distro. Where do you get it. In Ubuntu I could just run sudo apt-get install php-dev, (apparently) and it would just appear by magic. At least that's what the webpage said. Unfortunately I am running MacOSX version Leopard. How can I build this GD module on Leopard so that it will match the API number in my PHP?

    Read the article

  • NFS4 permission denied when userid does not match (even though idmap is working)

    - by SystemParadox
    I have NFS4 setup with idmapd working correctly. ls -l from the client shows the correct user names, even though the user ids differ between the machines. However, when the user ids do not match, I get 'permission denied' errors trying access files, even though ls -l shows the correct username. When the user ids do happen to match by coincidence, everything works fine. sudo sysctl -w sunrpc.nfsd_debug=1023 gives the following output in the server syslog for the failed file access: nfsd_dispatch: vers 4 proc 1 nfsv4 compound op #1/3: 22 (OP_PUTFH) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsv4 compound op ffff88003d0f5078 opcnt 3 #1: 22: status 0 nfsv4 compound op #2/3: 3 (OP_ACCESS) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsv4 compound op ffff88003d0f5078 opcnt 3 #2: 3: status 0 nfsv4 compound op #3/3: 9 (OP_GETATTR) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsv4 compound op ffff88003d0f5078 opcnt 3 #3: 9: status 0 nfsv4 compound returned 0 nfsd_dispatch: vers 4 proc 1 nfsv4 compound op #1/7: 22 (OP_PUTFH) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsv4 compound op ffff88003d0f5078 opcnt 7 #1: 22: status 0 nfsv4 compound op #2/7: 32 (OP_SAVEFH) nfsv4 compound op ffff88003d0f5078 opcnt 7 #2: 32: status 0 nfsv4 compound op #3/7: 18 (OP_OPEN) NFSD: nfsd4_open filename dom_file op_stateowner (null) renewing client (clientid 4f96587d/0000000e) nfsd: nfsd_lookup(fh 28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba, dom_file) nfsd: fh_verify(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking nfsd: fh_lock(28: 00070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) locked = 0 nfsd: fh_compose(exp 08:01/22806529 srv/dom_file, ino=22809724) nfsd: fh_verify(36: 01070001 015c0001 00000000 9853d400 2a4892a5 4918a0ba) nfsd: fh_verify - just checking fh_verify: srv/dom_file permission failure, acc=804, error=13 nfsv4 compound op ffff88003d0f5078 opcnt 7 #3: 18: status 13 nfsv4 compound returned 13 Is that useful to anyone? Any hints on to debug this would be greatly appreciated. Server kernel: 2.6.32-40-server (Ubuntu 10.04) Client kernel: 3.2.0-27-generic (Ubuntu 12.04) Same problem with my new server running 3.2.0-27-generic (Ubuntu 12.04). Thanks.

    Read the article

  • postfix smtpd rejecting mail from outside network match_list_match: no match

    - by Loopo
    My postfix (V: 2.5.5-1.1) running on ubuntu server (9.04) started to reject mail arriving in from outside about 2 weeks ago. Doing a "manual" session via telnet shows that the connection is always closed after the MAIL FROM: [email protected] line is input, with the message "Connection closed by foreign host." Doing the same from another client inside the LAN works fine. In the log files I get the line "lost connection after MAIL from xxxxx.tld[xxx.xxx.xxx.xxx]" This is after some lines like: match_hostaddr: XXX.XXX.XXX.XXX ~? [::1]/128 match_hostname: XXXX.tld ~? 192.168.1.0/24 ... match_list_match: xxx.xxx.xxx.xxx: no match which seem to suggest some kind of filter which checks for allowed addresses. I have been unable to locate where this filter lives, or how to turn it off. I'm not even sure if that's what's causing my problem. Connections from inside the LAN don't get disconnected even though they also show a "match_list_match: ... no match" line. I didn't change any configuration files recently, below is my main.cf as it currently stands. I don't really know what all the parameters do and how they interact. I just set it up initially and it worked fine (up to recently). smtpd_banner = $myhostname ESMTP $mail_name (GNU) biff = no readme_directory = no # TLS parameters smtpd_tls_cert_file=/etc/ssl/certs/server.crt smtpd_tls_key_file=/etc/ssl/private/server.key #smtpd_use_tls=yes smtpd_tls_session_cache_database = btree:${data_directory}/smtpd_scache smtp_tls_session_cache_database = btree:${data_directory}/smtp_scache smtp_sasl_auth_enable = no smtp_use_tls=no smtp_sasl_password_maps = hash:/etc/postfix/smtp_auth myhostname = XXXXXXX.com alias_maps = hash:/etc/aliases alias_database = hash:/etc/aliases myorigin = /etc/mailname mydestination = XXXX.XXXX.com, XXXX.com, localhost.XXXXX.com, localhost relayhost = XXX.XXX.XXX.XXX mynetworks = 127.0.0.0/8 [::ffff:127.0.0.0]/104 [::1]/128 192.168.1.0/24 mailbox_command = procmail -a "$EXTENSION" mailbox_size_limit = 0 recipient_delimiter = + inet_interfaces = all smtpd_sasl_local_domain = #smtpd_sasl_auth_enable = yes smtpd_sasl_security_options = noanonymous smtpd_sasl_authenticated_header = yes broken_sasl_auth_clients = yes smtpd_recipient_restrictions = permit_mynetworks,permit_sasl_authenticated,reject_unauth_ when checking the process list, postfix/smtpd runs as smtpd -n smtp -t inet -u -c -o stress -v -v Any clues?

    Read the article

  • PTR and A record must match?

    - by somecallmemike
    RFC 1912 Section 2.1 states the following: Make sure your PTR and A records match. For every IP address, there should be a matching PTR record in the in-addr.arpa domain. If a host is multi-homed, (more than one IP address) make sure that all IP addresses have a corresponding PTR record (not just the first one). Failure to have matching PTR and A records can cause loss of Internet services similar to not being registered in the DNS at all. Also, PTR records must point back to a valid A record, not a alias defined by a CNAME. It is highly recommended that you use some software which automates this checking, or generate your DNS data from a database which automatically creates consistent data. This does not make any sense to me, should an ISP keep matching A records for every PTR record? It seems to me that it's only important if the IP address that the PTR record describes is hosting a service that is sensitive to DNS being mismatched (such as email hosting). In that case the forward zone would be configured under a domain name (examples follow the format 'zone - record'): domain.tld -> mail IN A 1.2.3.4 And the PTR record would be configured to match: 3.2.1.in-addr.arpa -> 4 IN PTR mail.domain.tld. Would there be any reason for the ISP to host a forward lookup for an IP address on their network like this?: ispdomain.tld -> broadband-ip-1 IN A 1.2.3.4

    Read the article

  • rsync --remove-source-files but only those that match a pattern

    - by Daniel
    Is this possible with rsync? Transfer everything from src:path/to/dir to dest:/path/to/other/dir and delete some of the source files in src:path/to/dir that match a pattern (or size limit) but keep all other files. I couldn't find a way to limit --remove-source-files with a regexp or size limit. Update1 (clarification): I'd like all files in src:path/to/dir to be copied to dest:/path/to/other/dir. Once this is done, I'd like to have some files (those that match a regexp or size limit) in src:path/to/dir deleted but don't want to have anything deleted in dest:/path/to/other/dir. Update2 (more clarification): Unfortunately, I can't simply rsync everything and then manually delete the files matching my regexp from src:. The files to be deleted are continuously created. So let's say there are N files of the type I'd like to delete after the transfer in src: when rsync starts. By the time rsync finishes there will be N+M such files there. If I now delete them manually, I'll lose the M files that were created while rsync was running. Hence I'd like to have a solution that guarantees that the only files deleted from src: are those known to be successfully copied over to dest:. I could fetch a file list from dest: after the rsync is complete, and compare that list of files with what I have in src:, and then do the removal manually. But I was wondering if rsync can do this by itself.

    Read the article

< Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >