Search Results

Search found 30896 results on 1236 pages for 'best buy'.

Page 705/1236 | < Previous Page | 701 702 703 704 705 706 707 708 709 710 711 712  | Next Page >

• How do I add a new key:value pair in existing JavaScript object?

  - by basit74

  I have a JavaScript object like: appointerment= {ids: '15,16,17', appointments: {'15': '12.05.2010,14,05,2010'} } now in appointments object I want to add something like '16': '21.05.2010' what is the best possible way to do this?

  Read the article

• sed or greo or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

  Read the article

• getting all of the image absolute path in a page?

  - by ryanxu

  I am trying to get the src of all of the images in a page. But some pages use absolute paths and some do not. So I am wondering whats the best way to do this? right now I am using this. $imgsrc_regex = '#<\s*img [^\>]*src\s*=\s*(["\'])(.*?)\1#im'; preg_match_all($imgsrc_regex, $html, $matches);

  Read the article

• Detecting a website's framework

  - by Rakesh Juyal

  I was reading the article "50 of the Best Websites Developed Using Ruby on Rails". It seems quite impressive. But is there any way to find out which framework any specific website uses? Say dzone.com, how could I find out which framework it is using? How could I find websites made with, for example, the Spring Framework?

  Read the article

• asp.net mvc getting html programitically in view

  - by mazhar

  What is the best way to get HTML programmatically in the view from the controller. I sometimes use string builder for that to render some html and send it the view from the controller.is it efficient? What do you people suggests?

  Read the article

• Is MapReduce such a generalisation of another programming principle?

  - by Zubair

  I'm getting into parallel programming and I'm studying mapreduce and other distributed algorithms. Is it best just to learn mapreduce or is there a more general algorithm that will serve me better?

  Read the article

• Visual Map about Microsoft development products

  - by Eduardo

  Hello: I listen much about new Microsoft terminologies such as WPF, WCF, WWF, ASP.NET MVC, Silverlight, entity framework, LINQ. I would like to see in a visual map: 1) how these products interrelate 2) Which are complements of which. 3) Order of priority to learn I think all the names that I mentioned, together with the use of Visual Studio applies to web developments. I need a good answer to guide my efforts of Web development in the best way. Thanks.

  Read the article

• ms-access: specifying formatting for a column

  - by every_answer_gets_a_point

  i would like all data that is entered into a specific column to always have a trailing comma and also i need the first character to always be a comma. how do i do this? the best solution is probably not in vba or sql but probably the properties of the table?

  Read the article

• How to get short URL inside my iPhone app?

  - by CastroAPZ

  I need to get a short URL from a long one (that I made inside my app). I think that I already read about this, but I couldn't find it anymore here in SO. Anyone has a piece of code or directions to point this out? Best Regards

  Read the article

• What license to use for translations of open source software

  - by vividos

  I'm writing an open source software that is licensed under the GPL. Now I'm offering that other users can translate the software, starting from an english translation I made by myself. What license or range of license may be best for translation of text strings, dialogs, etc.? As GPL is a software license, I thought about a Creative Commons license. The goal is so that all translations remain free and may be updated by other translators.

  Read the article

• MSBuild find value in file

  - by zachary

  So I run my task with ccnet and my task creates files. What is the best way to read the file and identify if there is a certain value in it from msbuild??

  Read the article

• Type hinting for functions in Clojure

  - by mikera

  I'm trying to resolve a reflection warning in Clojure that seems to result from the lack of type inference on function return values that are normal Java objects. Trivial example code that demonstrates the issue: (set! *warn-on-reflection* true) (defn foo [#^Integer x] (+ 3 x)) (.equals (foo 2) (foo 2)) => Reflection warning, NO_SOURCE_PATH:10 - call to equals can't be resolved. true What is the best way to solve this? Can this be done with type hints?

  Read the article

• Consolidate information held in a number of SQL Server Express Instances

  - by user321271

  Hi, I'm trying to determine the best architecture for creating an oData web service for information held in a number of SQL Server Express instances. The web service should provide a consolidated view of the data. All the SQL Server Express instances have the same DB schema. I was initially planning to use SQL server replication however as I understand it, SQL Server 2008 Express cannot be used as a publisher. Any help or suggestions would be appreciated.

  Read the article

• Twitter RSS pubDate format

  - by Dave

  In a twitter RSS feed the pubDate is published as Sat, Jun 5, 2010 19:20 Using PHP, whats the best way to convert this into the time lasped since published. For eaxmple, posted 4 minutes ago posted 1 hour ago posted 4 hours ago posted 1 day ago posted 2 days ago posted 1 month ago posted 2 months ago You help much appreciated

  Read the article

• Data Access Layer in Asp.Net

  - by Dark Rider

  Am Afraid If am Overdoing things here. We recently started a .Net project containig different Class Libraries for DAl,Services and DTO. Question is about our DAL layer we wanted a clean and easily maintained Data access layer, We wanted go with Entity Framework 4.1. So still not clear about what to opt for Plain ADO.Net using DAO and DAOImpl methodolgy or Entity Framework. Could any one please suggest the best approach.

  Read the article

• Detect and remove noise text

  - by yox

  Given a database table with lots of data in it, what is the best practice to remove noise text? I want to detect and remove strings like: fghfghfghfg qsdqsdqsd rtyrtyrty I'm using Java.

  Read the article

• Setting PATH in Makefile run by eclipse

  - by Chris Jefferson

  I have a Makefile which runs fine from a bash shell, but fails to run from Eclipse. This is because the path I am setting in my .bash_profile is not getting used. What is the best way of making this happen? Is there somewhere else I could put the path, to make sure it is invoked in non-interactive shells (which is I assume how eclipse is running make)?

  Read the article

• Migrating from C# to C++

  - by Anupam Mehra

  My new job needs me to migrate from C# to C++. I am comfortable with C# and have an exposure to C++ at college (basics). What would be the best way to go forward. Please suggest some materials or books to go forward.

  Read the article

• limiting user actions by months

  - by Ahmet vardar

  hi my users upload photo and all uploads recorded in mysql with the date info. i want to limit uploads by the months. user may just upload 3 pics in a month. what is the best way to do this ? cheers

  Read the article

• svn: default name for a tag when name is not important?

  - by Jason S

  I need to tag the current state of my source tree in svn. My problem is I don't care what the name is, I just need to mark the current revision in an immutable* manner. (*subject to malicious behavior) What's the best way to do this? branches/ tags/ ??? trunk/ should ??? be the date, an incrementing sequence, the repository rev # ...?

  Read the article

• switch easily between different main()

  - by lezebulon

  I'm using VS2010 I have a project with several headers and one file with the main() function. For testing purposes I'd like to be able to easily another main() function that would instanciate different things than my original main. Is there an easy way to define 2 "main" function, and easily switch between them? The best would be to compile 2 binaries, one that starts at main1() and the other at main2(), or it can be a solution that requires to recompile some files, it doesn't matter

  Read the article

• How can I get and use a user's TZ setting from their .bashrc in a Perl CGI script?

  - by John

  Each of my users has a (possibly) different TZ defined in their .bashrc. I have a Perl script that displays date/time and want it to have it display with their profile time zone. Does anyone know the best way to do this?

  Read the article

• how and when to update a mysql index?

  - by fayer

  im using this sql query to create an index: $query = "CREATE INDEX id_index2 ON countries(geoname_id, name)"; but how do i update the index when new entries are added? should i run a php script with the update query in CRON and run it every night? is this best practice for automated index updating?

  Read the article

• C# Reflection Enum Option To Constant Value

  - by Andrew Florko

  I have the code that reflects enum (DictionaryType) option to Guid in very straight-forward way if (dictionaryType == DictionaryType.RegionType) return Consts.DictionaryTypeId.RegionType; if (dictionaryType == DictionaryType.Nationality) return Consts.DictionaryTypeId.Nationality; Please, suggest me the best way to reflect Enum option to static readonly guid value. Thank you in advance

  Read the article

• regex removing specified empty xml tag using C#

  - by John

  Hi, I would like to remove tag like the following one with its attributes using C# .Net how can i do it? <aaa type="1" class="2" /> other tags like <bbb type="5" class="4" /> i would like to keep. Best Regards,

  Read the article

< Previous Page | 701 702 703 704 705 706 707 708 709 710 711 712  | Next Page >