Search Results

Search found 30896 results on 1236 pages for 'best buy'.

Page 709/1236 | < Previous Page | 705 706 707 708 709 710 711 712 713 714 715 716  | Next Page >

  • Extended MAPI: How to get the entry ID of messages moved by CopyMessages

    - by marijne
    I have found that if I move a message using IMAPIFolder::CopyMessages (using the MESSAGE_MOVE flag) the message gets a new entry ID. However I do not see any reliable way of getting the entry ID of the message in its new location, or otherwise getting a reference to it. The best suggestion I have had so far involves tagging the message with the old custom property before moving, and then doing a search afterwards, but I was wondering if there is a less convoluted solution.

    Read the article

  • PHP script sample for iPhone hi-score/survey uploading?

    - by Horace Ho
    I am looking for a PHP example/tutorial which can accept hi-scores/survey upload from an iPhone. Hopefully, the PHP script: accepts POST, in additional to GET works over SSL (https) connects to MySQL In addition, it'd best the iPhone can get a session from the server and submit the session value along with the hi-score. Thanks

    Read the article

  • Copying subversion commit messages

    - by Falcor
    I know this isn't the BEST practice, but every once in a while when I'm merging up a huge batch up changes with the trunk (and I know my branch is current), I will simply delete the contents of the trunk and then copy the contents of my branch up, so that I don't have to deal with resolving conflicts for an hour. The problem is that I seem to lose the entire history of commit messages for each file. My branch still has the correct history of commit messages... how can I merge them up?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Improving performance for WRITE operation on Oracle DB in Java

    - by Lucky
    I've a typical scenario & need to understand best possible way to handle this, so here it goes - I'm developing a solution that will retrieve data from a remote SOAP based web service & will then push this data to an Oracle database on network. Also, this will be a scheduled task that will execute every 15 minutes. I've event queues on remote service that contains the INSERT/UPDATE/DELETE operations that have been done since last retrieval, & once I retrieve the events for last 15 minutes, it again add events for next retrieval. Now, its just pushing data to Oracle so all my interactions are INSERT & UPDATE statements. There are around 60 tables on Oracle with some of them having 100+ columns. Moreover, for every 15 minutes cycle there would be around 60-70 Inserts, 100+ Updates & 10-20 Deletes. This will be an executable jar file that will terminate after operation & will again start on next 15 minutes cycle. So, I need to understand how should I handle WRITE operations (best practices) to improve performance for this application as whole ? Current Test Code (on every cycle) - Connects to remote service to get events. Creates a connection with DB (single connection object). Identifies the type of operation (INSERT/UPDATE/DELETE) & table on which it is done. After above, calls the respective method based on type of operation & table. Uses Preparedstatement with positional parameters, & retrieves each column value from remote service & assigns that to statement parameters. Commits the statement & returns to get event class to process next event. Above is repeated till all the retrieved events are processed after which program closes & then starts on next cycle & everything repeats again. Thanks for help !

    Read the article

  • Ways to restrict WCF Service so only our apps can access it.

    - by RP
    I have a public WCF Service. I have a WPF Desktop app & a silverlight app. My apps does not have any login requirements. I want to make it difficult for another developer / website to make use of my service. What's the best way to restrict access to my service? Use SSL and have the desktop / silverlight app store a token inside of it?

    Read the article

  • Database design

    - by Hadad
    Hello, I've a system, that have two types of users (Companies and individuals).all types have a shared set of properties but they differ in another. What is the best design merge all in one table that allows null for unmatched properties, or separate them in two tables related to a basic table with a one to one relationship. Thanks.

    Read the article

  • Can I use php's fwrite with 644 file permissions?

    - by filip
    I am trying to set up automated .htaccess updating. This clearly needs to be as secure as possible, however right now the best I can do file permission-wise is 666. What can I do to setup either my server or php code so that my script's fwrite() command will work with 644 or better? For instance is there a way to set my script(s) to run as owner?

    Read the article

  • svn: default name for a tag when name is not important?

    - by Jason S
    I need to tag the current state of my source tree in svn. My problem is I don't care what the name is, I just need to mark the current revision in an immutable* manner. (*subject to malicious behavior) What's the best way to do this? branches/ tags/ ??? trunk/ should ??? be the date, an incrementing sequence, the repository rev # ...?

    Read the article

  • Android "hello world" - versions

    - by Ianb
    Starter question: My "Hello World" attempt won't run, ("No compatible targets were found"), I think this is bacause I selected the latest version for my project (2.2), and the highest AVD version is 2.0.1. Does this make sense? Can I change my project version (haven't been able to find a way to do this), or do I have to start again? If the versions are not backwards compatible, what is the best version to use for the majority of Android devices out there? Thanks

    Read the article

  • Parsing complicated query parameters

    - by Will
    My Python server receives jobs that contain a list of the items to act against, rather like a search query term; an example input: (Customer:24 OR Customer:24 OR (Group:NW NOT Customer:26)) To complicate matters, customers can join and leave groups at any time, and the job should be updated live when this happens. How is best to parse, apply and store (in my RDBMS) this kind of list of constraints?

    Read the article

  • Why is there no middleware in Erlang?

    - by Zubair
    I asked a question earlier about ESBs written in Erlang or Java, and there didn't seem to be anything in Erlang, and only products in Java. http://stackoverflow.com/questions/2453641/what-would-be-the-best-language-in-which-to-write-an-esb/2453683#2453683 I guess I find it difficult to understand why a language like Erlang has no such middleware products, especially seeing as it should be ideally suited to the job.

    Read the article

  • Can I declare the same value for two attributes at once

    - by graphicdivine
    For example, for accessibility reasons I want my onfocus and onmouseover to have identical values. For the sake of maintainability I want to declare this once only. What I'd like to be able to do is this: <a onmouseover,onfocus="assist('hello');">linktext</a> But, of course, that would be too easy, and doesn't work. What's the best way I can achieve this DRYing out of my tags?

    Read the article

  • jQuery ajax.load div, then have parent container access property

    - by Brett
    So I have a tabbed ui "form", each tab is quiet complicated so it is loaded via the .load('item.html'); command. All good, when the user clicks to a different tab, I want to read a property, maybe execute a function from within the ajax loaded div. What is the best way to get to these properties and methods from outsite the ajax loaded div?

    Read the article

  • grails: quering in a composite structure

    - by Asaf David
    hey i have the following domain model: class Location { String name static hasMany = [locations:Location, persons:Person] } class Person { String name } so basically each location can hold a bunch of people + "sub-locations". what is the best way to recursively query for all persons under a location (including it's sub locations, and their sub locations, etc')?

    Read the article

  • How can I measure the speed of code written in Java? (AI algorithms)

    - by Registered User
    Hi All, How can I measure the speed of code written in Java? I planning to develop software which will solve Sudoku using all presently available AI and ML algorithms and compare time against simple brute-force method. I need to measure time of each algorithm, I would like to ask for suggestions on what is the best way of doing that? Very important, program must be useful on any machine regardless to CPU power/memory. Thank you.

    Read the article

  • Ruby: Allowing a module to have settings

    - by JP
    If I'm building a library in ruby, what's the best way to allow users of the library to set module-wide settings that will be available to all sub classes etc of the library? A good example would be if I'm writing a library for posting to a webservice: TheService::File.upload("myfile.txt") # Uploads anonymously TheService::Settings.login("myuser","mypass") # Or any other similar way of doing this TheService::File.upload("myfile.txt") # Uploads as 'myuser' The idea would be that unless TheService::Settings.logout is called then all TheService operations would be conducted under myuser's account. Any ideas?

    Read the article

< Previous Page | 705 706 707 708 709 710 711 712 713 714 715 716  | Next Page >