Search Results

Search found 79383 results on 3176 pages for 'type system'.

Page 712/3176 | < Previous Page | 708 709 710 711 712 713 714 715 716 717 718 719  | Next Page >

  • Bind multiple request parameters to one object in Spring 3

    - by Max
    Hi, I can't figure out a way to bind several arguments and headers to one request parameter using annotations in Spring 3. For example, let's say I'm getting this request: Headers: Content-type: text/plain; POST Body: Name: Max Now I want it all to mysteriously bind to this object: class NameInfo { String name; } Using some code like this: String getName() { if ("text/plain".equals(headers.get("content-type"))) { return body.get("name"); } else if ("xml".equals(headers.get("content-type")) { return parseXml(body).get("name"); } else ... } So that in the end I would be able to use: @RequestMapping(method = RequestMethod.POST) void processName(@RequestAttribute NameInfo name) { ... } Is there a way to achieve something similar to what I need? Thanks in advance.

    Read the article

  • Histogram matching - image processing - c/c++

    - by Raj
    Hello I have two histograms. int Hist1[10] = {1,4,3,5,2,5,4,6,3,2}; int Hist1[10] = {1,4,3,15,12,15,4,6,3,2}; Hist1's distribution is of type multi-modal; Hist2's distribution is of type uni-modal with single prominent peak. My questions are Is there any way that i could determine the type of distribution programmatically? How to quantify whether these two histograms are similar/dissimilar? Thanks

    Read the article

  • Grub Solaris FreeBSD dual boot

    - by pallavt
    I have solaris 10 installed on the first hard disk and freebsd installed on the second hard disk I edited the /boot/grub/menu.lst from solaris to the following title FreeBSD root (hd1,0) kernel /boot/loader Now when I try to boot into freebsd via the grub, it gives the following error root (hd1,0) Filesystem type unknown, partition type 0xee kernel /boot/loader Error 17: cannot mount selected partition

    Read the article

  • How can I store all the properties of a class in an array of objects?

    - by Richard77
    Hello, Let's say I've a class myClass which has few properties, such as property1, property2, perperty3, etc. Now, I'd like to populate an array with each of those properties so that, I can access each of them through its index. Is there an automatic way of doing so? Here's an example from SportsStore (Pro ASPN.NET MVC/Steve Sanderson/Apress) on how to gather all the active controllers in the the 'Assembly'. var controllerTypes = from t in Assembly.GetExecutingAssembly().GetTypes() where typeof(IController).IsAssignableFrom(t) select t; foreach(Type t in controllerTypes) //Do something I wonder if there is some thing like the one above I can use to collect (only) properties of a class and store them in a array, no matter each one's type value (int, string, or custom type) I hope I was able to express myself clearly. Otherwise I can amend the text. Thanks for helping.

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Configure Apache with a htaccess file to strip out unneeded respond-headers.

    - by Koning Baard XIV
    For ultimate speed, I want my Apache server strip unneeded headers from the response. Currently, the headers looks like this (excluding the status header): Connection:Keep-Alive Content-Length:200 Content-Type:text/html Date:Sat, 15 May 2010 16:28:37 GMT Keep-Alive:timeout=5, max=100 Server:Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 PHP/5.3.1 Phusion_Passenger/2.2.7 X-Powered-By:PHP/5.3.1 Which I want to be like: Connection:Keep-Alive Content-Type:text/html Keep-Alive:timeout=5, max=100 How can I configure this in a .htaccess file? Thanks

    Read the article

  • VB.net Cross-Thread

    - by PandaNL
    Hello, I have a cmd command that needs to be executed, when the command starts it starts to fill a progressbar. When the cmd command is done the progressbar needs to fill up to 100. This is the code i use, but it gives me an error when the progressbar.Value = 100 comes up. Public Class Form1 Dim teller As Integer Private Sub Timer1_Tick(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles TimerProgressbar.Tick teller += 1 ProgressBar1.Value = teller If ProgressBar1.Value = ProgressBar1.Maximum Then TimerProgressbar.Stop() End If End Sub This are the tow commands in another private sub where the app is crashing on ProgressBar1.Value = 100 TimerProgressbar.Stop() When i debug it and i try it out it crashes on ProgressBar1.Value = 100 But when i build it under Windows 7 it runs fine without crashing, however a few people reported me it crashes on there Windows xp system. VB gives me a suggestions about Cross Thread, but i don't know how i could make it work with this.

    Read the article

  • Why won't IsChecked change on this toggle button?

    - by cjroebuck
    I have the following xaml for a toggle button: <ToggleButton Margin="0,3" Grid.Row="3" Grid.ColumnSpan="2" Command="{Binding DataContext.SelectAllCommand, Mode=OneWay, RelativeSource={RelativeSource FindAncestor, AncestorType={x:Type UserControl}}}"> <ToggleButton.Style> <Style TargetType="{x:Type ToggleButton}"> <Setter Property="Content" Value="Select All"/> <Style.Triggers> <Trigger Property="IsChecked" Value="True"> <Setter Property="Content" Value="Select None"/> <Setter Property="Command" Value="{Binding DataContext.SelectNoneCommand, Mode=OneWay, RelativeSource={RelativeSource FindAncestor, AncestorType={x:Type UserControl}}}"/> </Trigger> </Style.Triggers> </Style> </ToggleButton.Style> </ToggleButton> But the IsChecked property never gets updated when clicking the button. If I use snoop and force the IsChecked to True then the trigger kicks in.

    Read the article

  • polymorphic hql

    - by Berryl
    I have a base type where "business id" must be unique for a given subclass, but it is possible for there to be different subclasses with the same business id. If there is a base type with a requested id but of the wrong subclass I want to return null, using a named query. The code below does this, but I am wondering if I can avoid the try/catch with a better HQL. Can I? Cheers, Berryl current hql <query name="FindActivitySubjectByBusinessId"> <![CDATA[ from ActivitySubject act where act.BusinessId = :businessId ]]> </query> current fetch code public ActivitySubject FindByBusinessId<T>(string businessId) where T : ActivitySubject { Check.RequireStringValue(businessId, "businessId"); try { return _session.GetNamedQuery("FindActivitySubjectByBusinessId") .SetString("businessId", businessId) .UniqueResult<T>(); } catch (InvalidCastException e) { // an Activity Subject was found with the requested id but the wrong type return null; } }

    Read the article

  • WCF Runtime Error while using Constructor

    - by Pranesh Nair
    Hi all, I am new to WCF i am using constructor in my WCF service.svc.cs file....It throws this error when i use the constructor The service type provided could not be loaded as a service because it does not have a default (parameter-less) constructor. To fix the problem, add a default constructor to the type, or pass an instance of the type to the host. When i remove the constructor its working fine....But its compulsory that i have to use constructor... This is my code namespace UserAuthentication { [ServiceBehavior(InstanceContextMode=System.ServiceModel.InstanceContextMode.Single)] public class UserAuthentication : UserRepository,IUserAuthentication { private ISqlMapper _mapper; private IRoleRepository _roleRepository; public UserAuthentication(ISqlMapper mapper): base(mapper) { _mapper = mapper; _roleRepository = new RoleRepository(_mapper); } public string EduvisionLogin(EduvisionUser aUser, int SchoolID) { UserRepository sampleCode= new UserRepository(_mapper); sampleCode.Login(aUser); return "Login Success"; } } } can anyone provide ideas or suggestions or sample code hw to resolve this issue...

    Read the article

  • Change values in first key from 0 to count(array) - 1

    - by sologhost
    Ok, I have an array like so: $myArray[32]['value'] = 'value1'; $myArray[32]['type'] = 'type1'; $myArray[33]['value'] = 'value2'; $myArray[33]['type'] = 'type2'; $myArray[35]['value'] = 'value3'; $myArray[42]['value'] = 'value4'; $myArray[42]['type'] = 'type4'; Ok, looking for a quick way to change all numbers in the first key 32, 33, 35, and 42 into 0, 1, 2, and 3 instead. But I need to preserve the 2nd key and all of the values. The array is already ordered correctly, since I ordered it using a ksort, but now I need to reset the array from 0 - count($myArray) - 1 and keep the 2nd key intact and its value as well. Can someone please help me?

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • Spring.net - how to choose implementation of interface in runtime ?

    - by rouen
    Hi, in all examples of spring.net IoC i can see something like this: interface IClass; class ClassA : IClass; class ClassB : IClass, and then in config.xml file something like [object id="IClass" type="ClassB, Spring.Net.Test" /] but, i really need to do something like this: in config file there will be more implementations if interface: [object id="IClass" type="ClassA, Blah" /] [object id="IClass" type="ClassB, Blah" /] and then, in runtime i choose from them, something like this: IClass c = [get me all implementations of IClass, and choose the one with GetType().FullName == myVariableContainingFullTypeNameOfObjectIWant] how can i do something like this please, i cant google anything for hours.... many thanks !

    Read the article

  • Java - getClassLoader().getResource() driving me bonkers

    - by Click Upvote
    I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • .ogg video not playing in firefox

    - by Joseph Silvashy
    We're just getting started with html5 video, and cannot seem to get .ogg files to play in Firefox, any tips? Here is the source we are using: <video width="640" height="360" poster="http://video.thewebreel.com/episode_001/episode_001.jpg" controls autoplay autobuffer> <source src="http://video.thewebreel.com/episode_001/episode_001.ogg" type="video/ogg" type='video/ogg; codecs="theora, vorbis"'/> <source src="http://video.thewebreel.com/episode_001/episode_001.mp4" type="video/mp4" /> </video> The live example can be seen here: http://thewebreel.com/2010/05/02/episode-1.html However we are totally baffled, everything seems exactly right.

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • Identifying an empty text node with jQuery + Javascript

    - by b. e. hollenbeck
    You'd think this was easy - but I'm having the hardest time with it. Here's what I'm trying to identify: <span class="cw-value-one"></span> Here's what I'm using so far: $('span.cw-value-one').each(function(){ var textNode = $(this).text(); var type = typeof textNode; var len = textNode.length; if($(this).is(':empty')){ $(this).siblings('span.cw-value-two').css({"position": "relative", "left": "1em"}); } }); Ok, so textNode = "", type = string and len = 1 - none of which is helpful in identifying an empty text node, since a has a type of string and length of 1. The jQuery .is(':empty') is not working either. So whow do you identify an empty text node in JQuery or plain ol' Javascript?

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • Including inline javascript using content_for in rails

    - by TenJack
    I am using content_for and yeild to inject javascript files into the bottom of my layout but am wondering what the best practice is for including inline javascript. Specifically I'm wondering where the put the script type declaration: <% content_for :javascript do %> <script type="text/javascript"> ... </script> <% end %> or <% content_for :javascript do %> ... <% end %> <script type="text/javascript"> <%= yield :javascript %> </script> <% end %> I am using the first option now and wondering if it is bad to include multiple ... declarations within one view. Sometimes I have partials that lead to this.

    Read the article

  • Perl program doesn't get displayed in browser (windows)

    - by Dextar
    system info: i have installed XAMPP on my machine having Window XP OS . also installed Apache2.2, now, i have created two folders in C:\xampp\htdocs they are php and perl . these folder contains programs in their respective languages (ie index.php and index.pl respectively) when i type in browser : http: //localhost:88/php/ the program in index.php gets executed and o/p is displayed in browser but , when i type: http://localhost:88/perl/ browser displays a blank page PROBLEM : how to run .pl file in above scenario ?

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

  • Piping to findstr's input, dos prompt

    - by Gauthier
    I have a text file with a list of macro names (one per line). My final goal is to get a print of how many times the macro's name appears in the files of the current directory. The macro's names are in C:\temp\macros.txt. type C:\temp\macros.txt in the dos prompt prints the list alright. Now I want to pipe that output to the standard input of findstr. type C:\temp\macros.txt | findstr *.ss (ss is the file type where I am looking for the macro names). This does not seem to work, I get no result (very fast, it does not seem to try at all). findstr <the first row of the macro list> *.ss does work. I also tried findstr *.ss < c:\temp\macros.txt with no success.

    Read the article

< Previous Page | 708 709 710 711 712 713 714 715 716 717 718 719  | Next Page >