Search Results

Search found 79383 results on 3176 pages for 'type system'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 712/3176 | < Previous Page | 708 709 710 711 712 713 714 715 716 717 718 719  | Next Page >

  • "make menuconfig" throwing cannot find -lc error in my Fedora 11 PC

    - by Sen
    When i try to do a make menuconfig in a Fedora 11 machine it is throwing the following error message: [root@PC04 kernel]# make menuconfig HOSTCC -static scripts/basic/fixdep scripts/basic/fixdep.c: In function âtrapsâ: scripts/basic/fixdep.c:377: warning: dereferencing type-punned pointer will break strict-aliasing rules scripts/basic/fixdep.c:379: warning: dereferencing type-punned pointer will break strict-aliasing rules /usr/bin/ld: cannot find -lc collect2: ld returned 1 exit status make[1]: *** [scripts/basic/fixdep] Error 1 make: *** [scripts_basic] Error 2 Please help me on this issue? How can i solve this? Thanks, Sen

    Read the article

  • WSS 3.0 navigation structure

    - by Dante
    Hi all, I'm a beginner in WSS 3.0 and I'm having some problems with the navigation setup. I can't find any documentation that clearly recommends best practices in this area. I'm trying to create an intranet, custom look and feel, that should have a structure similar to: Company - News - News type 1 - News type 2 - Organogram - ... Employees - Employees 1 - Employees 2 - Employees 2_1 - ... How to properly set this up? Company, News, are sites/subsites? And News type 1 and 2 are pages within a site? I created as described above and in the master page of the main site I added some scripts that will be used by web parts, like jquery. The subsites will have their own master page and will not recognize the scripts, I need to add them there which is annoying. Any recommendations? Or some resource that provides best practices setting up these structures? Thx in advance

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • .ogg video not playing in firefox

    - by Joseph Silvashy
    We're just getting started with html5 video, and cannot seem to get .ogg files to play in Firefox, any tips? Here is the source we are using: <video width="640" height="360" poster="http://video.thewebreel.com/episode_001/episode_001.jpg" controls autoplay autobuffer> <source src="http://video.thewebreel.com/episode_001/episode_001.ogg" type="video/ogg" type='video/ogg; codecs="theora, vorbis"'/> <source src="http://video.thewebreel.com/episode_001/episode_001.mp4" type="video/mp4" /> </video> The live example can be seen here: http://thewebreel.com/2010/05/02/episode-1.html However we are totally baffled, everything seems exactly right.

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • Including inline javascript using content_for in rails

    - by TenJack
    I am using content_for and yeild to inject javascript files into the bottom of my layout but am wondering what the best practice is for including inline javascript. Specifically I'm wondering where the put the script type declaration: <% content_for :javascript do %> <script type="text/javascript"> ... </script> <% end %> or <% content_for :javascript do %> ... <% end %> <script type="text/javascript"> <%= yield :javascript %> </script> <% end %> I am using the first option now and wondering if it is bad to include multiple ... declarations within one view. Sometimes I have partials that lead to this.

    Read the article

  • Perl program doesn't get displayed in browser (windows)

    - by Dextar
    system info: i have installed XAMPP on my machine having Window XP OS . also installed Apache2.2, now, i have created two folders in C:\xampp\htdocs they are php and perl . these folder contains programs in their respective languages (ie index.php and index.pl respectively) when i type in browser : http: //localhost:88/php/ the program in index.php gets executed and o/p is displayed in browser but , when i type: http://localhost:88/perl/ browser displays a blank page PROBLEM : how to run .pl file in above scenario ?

    Read the article

  • mvc components in codeigniter?

    - by ajsie
    in yii i could have mvc components (acts like an own application). could i have this too in codeigniter? eg. in SYSTEM/APPLICATION have a folder called COMPONENTS and in there i put stand-alone applications that would be a part of the application. components like ADDRESS BOOK, MAIL, TWITTER and so on. every component folder has folders like: models, views, controllers, config etc. so a component model extends the application model which in turn extends system's (code igniter) model. the same goes for view and controller. i've already got a lot of these components which i want to use in codeigniter. is it good idea to place them as i said in SYSTEM/APPLICATION/COMPONENTS or is there best practice for this?

    Read the article

  • Parsing String to Time and insert in mysqldatabase

    - by kawtousse
    Goal: Parse a string from an input type text into TIME type to be inserted in MYSQL Database. String start= request.getParameter("startp"); System.out.println("start:" +start); SimpleDateFormat sdf = new SimpleDateFormat("HH:mm:ss"); long ms=0; try { ms = sdf.parse(start).getTime(); System.out.println(" the value of ms is:" +ms); } catch (ParseException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } Time ts = new Time(ms); System.out.println("the value of ts is:" +ts); start:14:12 (value witch i entered actually in the form at the start field named startp) the value of ts is :01:00:00 java.text.ParseException: Unparseable date: "14:12" at java.text.DateFormat.parse(Unknown Source) ms not displayed I ensure that database type of the following parameter is TIME. Thanks.

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • SWT Filedialog Open into home folder

    - by Ivan
    I want to open a FileDialog window into the user home folder (i.e. /home/user or /Users/unsername) I read the user home folder, using System.getProperty: String homefolder = System.getProperty(user.home); And the variable containts the correct home folder. But when i set the filterpath in FileDialog, it opens (in linux) only the /home level not entering into the user home dir. This is the source code: FileDialog dialog = new FileDialog(shell); dialog.setText("Choose a certificate"); String platform = SWT.getPlatform(); String homefolder = System.getProperty("user.home"); dialog.setFilterPath(homefolder); Any idea? Here a screenshot:

    Read the article

  • Put text input inside label for radio button?

    - by Martijn
    I'm trying to make a radio group specifying a bunch of options, and an extra option "other" with a text input to specify. The code for this particular radio button I'm using is <input type='radio' name='RadioInput' value='Other' id='RadioInput_Other' /> <label for='RadioInput_Other'>Ohter: <input type='text' name='RadioInput_Other_Value' id='RadioInput_Other_Value' value='' /> </label> The idea is that if you give focus to the text input, the radio button corresponding to it is selected. The code above almost does this (since the text input is inside the label). However, it also shifts focus to the radio button (which is annoying, since whatever you type next is lost). Is there any way to prevent this using XHTML1.0 / CSS2? Preferably without using javascript.

    Read the article

  • Change values in first key from 0 to count(array) - 1

    - by sologhost
    Ok, I have an array like so: $myArray[32]['value'] = 'value1'; $myArray[32]['type'] = 'type1'; $myArray[33]['value'] = 'value2'; $myArray[33]['type'] = 'type2'; $myArray[35]['value'] = 'value3'; $myArray[42]['value'] = 'value4'; $myArray[42]['type'] = 'type4'; Ok, looking for a quick way to change all numbers in the first key 32, 33, 35, and 42 into 0, 1, 2, and 3 instead. But I need to preserve the 2nd key and all of the values. The array is already ordered correctly, since I ordered it using a ksort, but now I need to reset the array from 0 - count($myArray) - 1 and keep the 2nd key intact and its value as well. Can someone please help me?

    Read the article

  • Piping to findstr's input, dos prompt

    - by Gauthier
    I have a text file with a list of macro names (one per line). My final goal is to get a print of how many times the macro's name appears in the files of the current directory. The macro's names are in C:\temp\macros.txt. type C:\temp\macros.txt in the dos prompt prints the list alright. Now I want to pipe that output to the standard input of findstr. type C:\temp\macros.txt | findstr *.ss (ss is the file type where I am looking for the macro names). This does not seem to work, I get no result (very fast, it does not seem to try at all). findstr <the first row of the macro list> *.ss does work. I also tried findstr *.ss < c:\temp\macros.txt with no success.

    Read the article

  • Traditional ASP.NET application in subdirectory of an MVC application

    - by David
    Windows Server 2003, IIS6. We're trying to deploy a non-MVC ASP.NET web application as a subdirectory of an MVC application. However the ASP.NET application in the subdirectory is failing with the message "Could not load file or assembly 'System.Web.Mvc, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. The system cannot find the file specified." which is bizarre because it's not an MVC application.

    Read the article

  • C++ destructor seems to be called 'early'

    - by suicideducky
    Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • How to make if loop in grails?

    - by user3569696
    I'm beginner in Grails, please help. I have this in my gsp <div class="right66"> <g:select class="time_pick" name="pick_day" placeholder="" from="${['Dani', 'Sati', 'Minute']}" valueMessagePrefix="book.category"/> </div> In translation: Dani=Days, Sati= Hours, Minute= Minutes. I need to save data in minutes but User have privilege to choose will his input be in minutes, days or hours. So i have to do if loop. I now how if loop works but i don't know how to wite it in grails. I was thinking something like this: n=1 if(params.type=Dani){ n= 3600 }else if(params.type=Sati) { n=60 } def minute=params.minute*n but how to call that choosen input "Dani"? I can't write Params.type=Dani. Does if loop go in controller in my case?

    Read the article

  • Forbid access to DVD/CD/USB for some users

    - by alex2k8
    I need to forbid all users except administrators to write into DVD/CD/USB drives on Windows XP. Googled around and there is a way to disable devices completely: Cdrom: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\cdrom\Start (from 1 to 4) Usb: HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\USBSTOR (from 3 to 4) but I need to disable them only for particular users.

    Read the article

  • GCC, functions, and pointer arguments, warning behaviour

    - by James Morris
    I've recently updated to a testing distribution, which is now using GCC 4.4.3. Now I've set everything up, I've returned to coding and have built my project and I get one of these horrible messages: *** glibc detected *** ./boxyseq: free(): invalid pointer: 0x0000000001d873e8 *** I absolutely know what is wrong here, but was rather confused as to when I saw my C code where I call a function which frees a dynamically allocated data structure - I had passed it an incompatible pointer type - a pointer to a completely different data structure. warning: passing argument 1 of 'data_A_free' from incompatible pointer type note: expected 'struct data_A *' but argument is of type 'struct data_B *' I'm confused because I'm sure this would have been an error before and compilation would never have completed. Is this not just going to make life more difficult for C programmers? Can I change it back to an error without making a whole bunch of other warnings errors too? Or am I loosing the plot and it's always been a warning?

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 708 709 710 711 712 713 714 715 716 717 718 719  | Next Page >