Search Results

Search found 79383 results on 3176 pages for 'type system'.

Page 713/3176 | < Previous Page | 709 710 711 712 713 714 715 716 717 718 719 720  | Next Page >

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • Configure Apache with a htaccess file to strip out unneeded respond-headers.

    - by Koning Baard XIV
    For ultimate speed, I want my Apache server strip unneeded headers from the response. Currently, the headers looks like this (excluding the status header): Connection:Keep-Alive Content-Length:200 Content-Type:text/html Date:Sat, 15 May 2010 16:28:37 GMT Keep-Alive:timeout=5, max=100 Server:Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 PHP/5.3.1 Phusion_Passenger/2.2.7 X-Powered-By:PHP/5.3.1 Which I want to be like: Connection:Keep-Alive Content-Type:text/html Keep-Alive:timeout=5, max=100 How can I configure this in a .htaccess file? Thanks

    Read the article

  • How can I store all the properties of a class in an array of objects?

    - by Richard77
    Hello, Let's say I've a class myClass which has few properties, such as property1, property2, perperty3, etc. Now, I'd like to populate an array with each of those properties so that, I can access each of them through its index. Is there an automatic way of doing so? Here's an example from SportsStore (Pro ASPN.NET MVC/Steve Sanderson/Apress) on how to gather all the active controllers in the the 'Assembly'. var controllerTypes = from t in Assembly.GetExecutingAssembly().GetTypes() where typeof(IController).IsAssignableFrom(t) select t; foreach(Type t in controllerTypes) //Do something I wonder if there is some thing like the one above I can use to collect (only) properties of a class and store them in a array, no matter each one's type value (int, string, or custom type) I hope I was able to express myself clearly. Otherwise I can amend the text. Thanks for helping.

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • Spring.net - how to choose implementation of interface in runtime ?

    - by rouen
    Hi, in all examples of spring.net IoC i can see something like this: interface IClass; class ClassA : IClass; class ClassB : IClass, and then in config.xml file something like [object id="IClass" type="ClassB, Spring.Net.Test" /] but, i really need to do something like this: in config file there will be more implementations if interface: [object id="IClass" type="ClassA, Blah" /] [object id="IClass" type="ClassB, Blah" /] and then, in runtime i choose from them, something like this: IClass c = [get me all implementations of IClass, and choose the one with GetType().FullName == myVariableContainingFullTypeNameOfObjectIWant] how can i do something like this please, i cant google anything for hours.... many thanks !

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • iphone build error that makes me want to buy a nail gun

    - by sol
    I'm just trying to build a simple update (which I have done before) for an iphone app, but now for some reason I'm getting this error. Can anyone tell me what it means? Command/Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist failed with exit code 127 sh: plutil: command not found Here are the Build Results: CopyPNGFile /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png images/img_000.png cd /Users/me/ setenv COPY_COMMAND /Developer/Library/PrivateFrameworks/DevToolsCore.framework/Resources/pbxcp setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" "/Developer/Platforms/iPhoneOS.platform/Developer/Library/Xcode/Plug-ins/iPhoneOS Build System Support.xcplugin/Contents/Resources/copypng" -compress "" /Users/path/images/img_000.png /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png sh: dirname: command not found CopyPlistFile /Users/me/path/build/Dist-iphoneos/MyApp.app/Entitlements.plist Entitlements.plist cd /Users/me/ setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" /Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist --convert binary1 Entitlements.plist --outdir /Users/me/path/build/Dist-iphoneos/MyApp.app sh: plutil: command not found

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • C++ destructor seems to be called 'early'

    - by suicideducky
    Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

    Read the article

  • extend web server to serve static files

    - by Turtle
    Hello, I want to extend a web server which is only able to handle RPC handling now. The web server is written in C#. It provides a abstract handler function like following: public string owsHandler(string request, string path, string param, OSHttpRequest httpRequest, OSHttpResponse httpResponse) And I wrote following code to handle image files: Bitmap queryImg = new Bitmap(path); System.IO.MemoryStream stream = new System.IO.MemoryStream(); queryImg.Save(stream, System.Drawing.Imaging.ImageFormat.Bmp); queryImg.Dispose(); byte[] byteImage = stream.ToArray(); stream.Dispose(); return Convert.ToBase64String(byteImage); And I test it in the browser, the image is returned but the image dimension info is missed. Shall I add something more to the code? Or is any general way to server static files? I do not want to serve it in a ASP.net server. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • Fetching all uploaded,tagged in and share videos in Facebook by FQL

    - by himanshu
    In my app, i want to fetch all videos of logged in user i.e. videos that are uploaded by user, videos share by user, user tagged in etc. Currently im using "stream" query as: SELECT created_time, post_id, actor_id, type, updated_time, attachment FROM stream WHERE created_time>1075593600 AND type IN (56, 80, 128, 237, 272) AND source_id=me() limit 10000 As you can see i use "type IN" to fetch required videos but this query is not fetching all videos of mine . I have two videos in 2011 one of which is uploaded and other one is shared.But i m not getting these two. Also in developer.facebook it was written that "Each query of the stream table is limited to the previous 30 days or 50 posts, whichever is greater, however you can use time-specific fields such as created_time along with FQL operators (such as < or ) to retrieve a much greater range of posts." So i tried "created time0" i.e.(1970) and other like timestamp of 2001 but still i m not getting all. Please help..its urgent.Thanks

    Read the article

  • How To Make NHibernate Automatically change an "Updated" column

    - by IanT8
    I am applying NHibernate to an existing project, where tables and columns are already defined and fixed. The database is MS-SQL-2008. NHibernate 2.1.2 Many tables have a column of type timestamp named "ReplicationID", and also a column of type datetime named "UpdatedDT". I understand I might be able to use the element of the mapping file to describe the "ReplicationID" column which will allow NHibernate to manage that column. Is it possible to make NHibernate automatically update the UpdatedDT column when the row is updated? I suppose I could try mapping the UpdatedDT property to be of type timestamp, but that have other side effects.

    Read the article

  • WxPython Incompatible With Snow Leopard?

    - by Alex
    Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

    Read the article

  • Unable to out/retval parameter in COM interface method in VC++ 2008

    - by user196614
    Hi, I want to create a simple COM component in VC++ 2008. I have created ATL Project with all default options. I have added Simple ATL object (interface IDemo). Now I want to add a methos inside IDemo. But the "Add Method Wizard" does not allow me to add out/retval type of parameters to the method. I can add in type of parameters. Is it possible to add out/retval type of parameters? If yes then How can I do it? Thanks

    Read the article

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • Location of the fonts on the iPhone?

    - by Kyle
    I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

    Read the article

  • Windows Server 2003 W3SVC Failing, Brute Force attack possibly the cause

    - by Roaders
    This week my website has disappeared twice for no apparent reason. I logged onto my server (Windows Server 2003 Service Pack 2) and restarted the World Web Publishing service, website still down. I tried restarting a few other services like DNS and Cold Fusion and the website was still down. In the end I restarted the server and the website reappeared. Last night the website went down again. This time I logged on and looked at the event log. SCARY STUFF! There were hundreds of these: Event Type: Information Event Source: TermService Event Category: None Event ID: 1012 Date: 30/01/2012 Time: 15:25:12 User: N/A Computer: SERVER51338 Description: Remote session from client name a exceeded the maximum allowed failed logon attempts. The session was forcibly terminated. At a frequency of around 3 -5 a minute. At about the time my website died there was one of these: Event Type: Information Event Source: W3SVC Event Category: None Event ID: 1074 Date: 30/01/2012 Time: 19:36:14 User: N/A Computer: SERVER51338 Description: A worker process with process id of '6308' serving application pool 'DefaultAppPool' has requested a recycle because the worker process reached its allowed processing time limit. Which is obviously what killed the web service. There were then a few of these: Event Type: Error Event Source: TermDD Event Category: None Event ID: 50 Date: 30/01/2012 Time: 20:32:51 User: N/A Computer: SERVER51338 Description: The RDP protocol component "DATA ENCRYPTION" detected an error in the protocol stream and has disconnected the client. Data: 0000: 00 00 04 00 02 00 52 00 ......R. 0008: 00 00 00 00 32 00 0a c0 ....2..À 0010: 00 00 00 00 32 00 0a c0 ....2..À 0018: 00 00 00 00 00 00 00 00 ........ 0020: 00 00 00 00 00 00 00 00 ........ 0028: 92 01 00 00 ... With no more of the first error type. I am concerned that someone is trying to brute force their way into my server. I have disabled all the accounts apart from the IIS ones and Administrator (which I have renamed). I have also changed the password to an even more secure one. I don't know why this brute force attack caused the webservice to stop and I don't know why restarting the service didn't fix the problem. What should I do to make sure my server is secure and what should I do to make sure the webserver doesn't go down any more? Thanks.

    Read the article

  • Networking: Adding specific route for printer, on Mac Connected to Two Networks

    - by Jordan
    I have a Mac connected to two different networks (wireless en1 and ethernet en0 ). The ethernet network is the preferred (System Preferences-Set Service Order). I'd like to be able to print to a printer on the wireless network side, without having to go to System Preferences and make the wireless network come first in the service order. Is there a way to add a route for a specific printer?

    Read the article

< Previous Page | 709 710 711 712 713 714 715 716 717 718 719 720  | Next Page >