Search Results

Search found 70459 results on 2819 pages for 'file sync'.

Page 718/2819 | < Previous Page | 714 715 716 717 718 719 720 721 722 723 724 725  | Next Page >

  • Linux missing disk space

    - by cpt.Buggy
    I have KVM vps with strange disk usage: # df -h Filesystem Size Used Avail Use% Mounted on /dev/sdb 493G 1.2G 466G 1% / tmpfs 4.0G 0 4.0G 0% /dev/shm /dev/sda1 96M 41M 51M 45% /boot # du -sh / du: cannot access `/proc/1633/task/1633/fd/4': No such file or directory du: cannot access `/proc/1633/task/1633/fdinfo/4': No such file or directory du: cannot access `/proc/1633/fd/4': No such file or directory du: cannot access `/proc/1633/fdinfo/4': No such file or directory 1021M / How could it be? Where are ~20G of free space?

    Read the article

  • iTunes want to remove my existing apps on iPad

    - by Michael
    Here is the situation. I connected my iPad to some new PC, Synced, then ticking Sync Apps from Devices-Apps will give me warning that all existing apps on my iPad will be replaced with those from Library-Apps. But in Library I have just couple old apps, which long time ago I used. So how I can sync the library in iTunes with my existing apps from iPad? EDIT: I have tried to click on Transfer Purchases, but not all of the items went to the library, just few of them.

    Read the article

  • Why does my Windows Explorer no longer refresh itself?

    - by Markus
    Normally when you do a file operation in Windows Explorer then Explorer refreshes itself. So I delete a file, and it's gone. But since yesterday when I for example delete a file, the file entry doesn't disappear. It only disappears when closing and reopening the folder, or when pressing F5. What could that be?

    Read the article

  • rsync synchronizing files only without creating folders on destination

    - by Vincent
    Is it possible with rsync to not create directories on destination? Imagine I have that source : a/ a/x.txt b/ b/y.txt And that I have this destination : a/ a/z.txt The wanted result of rsync source destination : a/ a/x.txt a/z.txt Of course my real situation involves thousand files/folders structure and I don't want solutions involving explicit list of synced folders, which I can do. I'm looking for a clean way just to prevent any folder creation on destination. By exclude or filtering... That could even be something outside rsync, like a hack with permissions if rsync can't do this... For information, this is really easy to get this kind of situations, in my case I have: A server with 2 disks, let's say A & B. And a local drive C. I usually use rsync to sync (and merge) remote A & B into local C. Then sometimes I just want to sync back some C files into A and B. (Just new Files... not non-existing folders on destination)

    Read the article

  • How can I retrieve statistics from my ghost cast server?

    - by Foxtrot
    I have a GhostCast server running for deploying images. I would like to have each ghost cast session to write to a file ( can be multiple text files or append to one file already there ) statistics. I know this is possible based on the options GhostCast software provides for writing to a log file, but I would like this automated for every image being backed up and restored. I don't want to have my employees click write to a new file every time. Is this possible?

    Read the article

  • How to move mail accounts when migrating webhosting

    - by pkswatch
    I am migrating my website abc.com from one webhosting company to another in a shared hosting environment. Both have cpanel. And the second hosting account i am preparing to move is my multi-domain hosting account with 3 domains already in it. The problem is, i have many email accounts associated with my website abc.com, which are accessed using webmail. So if i move it to the other host, will i lose all those accounts and their emails? If yes, then how should i synchronise the email accounts so that all the accounts and the contained emails remain intact? I saw some several sync tools like IMAP Sync, etc. But these require two hosts while synchronizing, and as you see, i have just one domain name to be synchronized over 2 servers. PS, i do not have any ssh access on either of them, and i have made complete backup of all files using backup wizard in cpanel.

    Read the article

  • writting becomes slow after few writes

    - by user1566277
    I am running an embedded Linux on arm with a SD-Card. While writing huge amounts of data I see bizarre effects. E.g, when I dd a 15 MB file few times, it writes the file (normally) in less than 2 Secs. But After lets say 3-4 times it takes sometimes 15 to 30 Seconds to write the same file. If I sync after writing the file, then this does not happen but sync takes long time too. If there is enough gap between writing two files than presumably kernel syncs itself. How can I optimize the whole performance so that write should always finish inside 2 Seconds. The File system I am using is ext3. Any pointers?

    Read the article

  • Why Photoshop CS5's photomerge's result immediately disappear?

    - by koiyu
    I have a bunch of JPG-files which I want to stitch together with Photoshop's Photomerge function. I choose File → Automate → Photomerge... and browse for the files. Photoshop opens the files and starts analyzing. I see the process bar filling and different phases are mentioned on the process bar. Nothing weird there. When the merging is done (and if I don't blink my eyes), I can see layers-palette is populated with the chosen files and, by quickly judging from the layer thumbnails, they're properly aligned. Sometimes the image window itself can be seen, but not always. Problem is that the layers and the image disappear in a flash. There is no error message. Everything is like prior starting the photomerge. No file has been changed. I could continue to use Photoshop normally. This is what I've tried so far: Loaded folder which has 38 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded the same files, but chose Use Files instead of Use Folder in the photomerge's window Loaded 19 JPG images, 4272 x 2848 and ˜ 5 megabytes per file Loaded 10 JPG images, ⇑ see above Loaded 5 JPG images, see above Loaded 3 JPG images, see above Scaled the images to 2256 x 1504 and ˜< 1 megabytes per file Loaded in a set of 38, 19, 10, 5, 3 Following steps are tested with these smaller files and with a set of 5 images Read Adobe's forums and reduced the amount of RAM Photoshop uses gradually from ˜ 80 % to 50 % (though I didn't understand the logic behind this) Would've reduced cache tile size to 128K, but it was set so already Disabled OpenGL Scaled the images to 800 x 533 and ˜ 100 kilobytes per file, loaded a set of 5 Read more unanswered threads around the internet In between each test I closed and reopened Photoshop. This is the first time I've even tried using photomerge. Am I doing something wrong? How can I locate what is the problem? How do I fix this? Photoshop is 64 bit Extended CS5 version. I'm on a mid-2010 quad-core (i5) iMac with up-to-date Mac OS X 10.6.6. Edit: Weird. First loading the images into one file via File → Scripts → Load Files into Stack… and then using Edit → Auto-Align Layers…, which, effectively, is the same as photomerge (even the dialog looks kind of the same), works! Even with the original JPGs without any issues. This doesn't fix photomerge, though.

    Read the article

  • VMware Fusion on MacBook Pro running Vista, not working after installing a wireless card

    - by Shelley
    A tech friend installed VMware on my Mac so I could use my Windows programs as well. It worked great until I inserted my Sierra 881 USB wireless card while in VMware trying to get to the internet while on the road. It worked briefly, then the AT&T Communication manager won't respond when you click on the icon, I can't open Network and Sharing center, I can't sync my palm - shows it can't connect. Looks like it messed up several things, along with not being able to connect to the internet while in windows. This wireless cards works directly from the Mac - but I need internet while in Windows for some work I am doing. How do I uninstall this - when I try - it just gives me an endless reloading circle - not doing anything. I really need to sync my palm and get back to the way it was. I don't know much about VMware at all and I don't have access to my friend right now to get help.

    Read the article

  • Windows services not starting automatically?

    - by Jeff Atwood
    We've had some nasty time sync problems on our Windows Server 2008 R2 servers lately. I traced this back to something very simple: the Windows Time Service was not started! The time can't possibly sync via NTP when the time service isn't running... The Windows Time Service was set to start "automatically" in the services control panel, which I double and triple checked. I also checked the event logs and I didn't see any service failures or anything like that. In fact, it looked a heck of a lot like the Windows Time Service never started up automatically after the weekly Windows Updates were installed and the servers were rebooted. (this is set to happen every Saturday at 7 PM.) The minute I started the Time Service, the time synced fine. So, then, the question: why would a service set to start "Automatically" ... not be started automatically? That seems sort of crazy to me.

    Read the article

  • Convert Chinese character .wav song into .mp3 or .wma on English OS

    - by Jack
    I have bunch of Chinese .wav files on my hard disk that I'm trying to convert into .mp3 with Audacity but it appear that Audacity can not read Chinese character songs but the .wav file display correctly on my 32 bits Win7 Ultimate(English) pc. I have to rename these Chinese character songs into English file name in order to convert them. Does anyone know if there is any software (prefer open source) that will take Chinese character file name(.wav) and convert it into .mp3 without renaming the file?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Where does Skype save its chat history & contacts?

    - by user4796
    I'm aware that there is a main.db file that is stored in a Windows directory. On XP: C:\Documents and Settings\<windows user>\Application Data\Skype\<username> But I just downloaded Skype onto my Android and noticed that all chats are sync'd. So to me, this suggests that the main.db file is not the only storage being used (because it is obviously not on my phone). Are contacts and chat history stored in my online Skype account? Does anyone know where I can find more information about this? I read this thread: Does skype automatically save chat history to the cloud? And how do you explain the sync'd chats?

    Read the article

  • rsync filtering

    - by biomed
    I use an rsync command to sync two directories remote local the command is (used in python script) os.system('rsync --verbose --progress --stats --recursive\ --copy-links --times --include="*/" --include="*good_name*.good_ext*"\ --exclude-from "/myhome/mydir/src/rsync.exclude"\ %s %s'%(remotepath,localpath)) I want to exclude certain directories that has the same files that I also want to include. I want to include recursively any_dir_name/any_file_name.good but I want to exclude any and all files that are in bad_dir_name/ I used exclude-from and here is my exclude from file * /*.bad_dir_name/ Unfortunately it doesn't work. I suspect it may have something to do with --include="*/" but if I remove it the command doesn't sync any files at all. Thanks for the help.

    Read the article

  • Automatic picture size adjustment

    - by CChriss
    Does anyone know of a free utility that allows you to paste into it a graphics file (any type would work for me, jpg, bmp, png, etc) and it will size the file to within a preset size boundary? For instance, if I preset it to resize files to be a maximum of 400 wide by 300 tall, and I paste in a file 500x500, it would shrink the file to fit within the 300 tall limit. Thanks.

    Read the article

  • How Do I enable Safe Asynchronous Write With NFS?

    - by Joe Swanson
    The NFSv3 documentation talks alot about the concept of "safe asynchronous writes" (last bullet of A1): http://nfs.sourceforge.net/#section_a This is NOT referring to the sync/async option in the server exports file (as the async option in the exports file is NOT safe). As I understand it, safe asynchronous writes is a hybrid between the sync/async exports option. It allows for a server to reply back without flushing to stable storage immediately, but the client will not remove the write request from cache until it has received confirmation that it has been committed to stable storage (and also detects if the server looses power/reboots). I believe that this option is set on the client side, but I have not come across any documentation that shows how to do this. Any ideas?

    Read the article

  • How can I unzip a .tar.gz in one step (using 7-Zip)?

    - by quickcel
    I am using 7-Zip on Windows XP and whenever I download a .tar.gz file it takes me two steps to completely extract the file(s). I right-click on the example.tar.gz file and choose 7-Zip -- Extract Here from the context menu. I then take the resulting example.tar file and the right-click again and choose 7-Zip -- Extract Here from the context menu. Is there a way through the context menu to do this in one step?

    Read the article

  • Best way to administer a website remotely

    - by Mark Szymanski
    I have a Windows computer running an intranet website with IIS and I was wondering what the best way was to administer it from another computer, in this case, a Mac. What I want to do: Be able to edit pages from my Mac. VNC into the server because it is 'headless'. (Already have this set up) My current file syncing setup: I have Dropbox setup to sync files between the computers and then use PureSync to sync the files in the Dropbox folder into the wwwroot folder. Is there a better (faster/easier) way I could do all this? Thanks in advance!

    Read the article

  • How to design a high-level application protocol for metadata syncing between devices and server?

    - by Jaanus
    I am looking for guidance on how to best think about designing a high-level application protocol to sync metadata between end-user devices and a server. My goal: the user can interact with the application data on any device, or on the web. The purpose of this protocol is to communicate changes made on one endpoint to other endpoints through the server, and ensure all devices maintain a consistent picture of the application data. If user makes changes on one device or on the web, the protocol will push data to the central repository, from where other devices can pull it. Some other design thoughts: I call it "metadata syncing" because the payloads will be quite small, in the form of object IDs and small metadata about those ID-s. When client endpoints retrieve new metadata over this protocol, they will fetch actual object data from an external source based on this metadata. Fetching the "real" object data is out of scope, I'm only talking about metadata syncing here. Using HTTP for transport and JSON for payload container. The question is basically about how to best design the JSON payload schema. I want this to be easy to implement and maintain on the web and across desktop and mobile devices. The best approach feels to be simple timer- or event-based HTTP request/response without any persistent channels. Also, you should not have a PhD to read it, and I want my spec to fit on 2 pages, not 200. Authentication and security are out of scope for this question: assume that the requests are secure and authenticated. The goal is eventual consistency of data on devices, it is not entirely realtime. For example, user can make changes on one device while being offline. When going online again, user would perform "sync" operation to push local changes and retrieve remote changes. Having said that, the protocol should support both of these modes of operation: Starting from scratch on a device, should be able to pull the whole metadata picture "sync as you go". When looking at the data on two devices side by side and making changes, should be easy to push those changes as short individual messages which the other device can receive near-realtime (subject to when it decides to contact server for sync). As a concrete example, you can think of Dropbox (it is not what I'm working on, but it helps to understand the model): on a range of devices, the user can manage a files and folders—move them around, create new ones, remove old ones etc. And in my context the "metadata" would be the file and folder structure, but not the actual file contents. And metadata fields would be something like file/folder name and time of modification (all devices should see the same time of modification). Another example is IMAP. I have not read the protocol, but my goals (minus actual message bodies) are the same. Feels like there are two grand approaches how this is done: transactional messages. Each change in the system is expressed as delta and endpoints communicate with those deltas. Example: DVCS changesets. REST: communicating the object graph as a whole or in part, without worrying so much about the individual atomic changes. What I would like in the answers: Is there anything important I left out above? Constraints, goals? What is some good background reading on this? (I realize this is what many computer science courses talk about at great length and detail... I am hoping to short-circuit it by looking at some crash course or nuggets.) What are some good examples of such protocols that I could model after, or even use out of box? (I mention Dropbox and IMAP above... I should probably read the IMAP RFC.)

    Read the article

  • Windows Azure Learning Plan - SQL Azure

    - by BuckWoody
    This is one in a series of posts on a Windows Azure Learning Plan. You can find the main post here. This one deals with Security for  Windows Azure.   Overview and Training Overview and general  information about SQL Azure - what it is, how it works, and where you can learn more. General Overview (sign-in required, but free) http://social.technet.microsoft.com/wiki/contents/articles/inside-sql-azure.aspx General Guidelines and Limitations http://msdn.microsoft.com/en-us/library/ee336245.aspx Microsoft SQL Azure Documentation http://msdn.microsoft.com/en-us/windowsazure/sqlazure/default.aspx Samples and Learning Sources for online and other SQL Azure Training Free Online Training http://blogs.msdn.com/b/sqlazure/archive/2010/05/06/10007449.aspx 60-minute Overview (webcast) https://msevents.microsoft.com/CUI/WebCastEventDetails.aspx?culture=en-US&EventID=1032458620&CountryCode=US Architecture SQL Azure Internals and Architectures for Scale Out and other use-cases. SQL Azure Architecture http://social.technet.microsoft.com/wiki/contents/articles/inside-sql-azure.aspx Scale-out Architectures http://tinyurl.com/247zm33 Federation Concepts http://tinyurl.com/34eew2w Use-Cases http://blogical.se/blogs/jahlen/archive/2010/11/23/sql-azure-why-use-it-and-what-makes-it-different-from-sql-server.aspx SQL Azure Security Model (video) http://www.msdev.com/Directory/Description.aspx?EventId=1491 Administration Standard Administrative Tasks and Tools Tools Options http://social.technet.microsoft.com/wiki/contents/articles/overview-of-tools-to-use-with-sql-azure.aspx SQL Azure Migration Wizard http://sqlazuremw.codeplex.com/ Managing Databases and Login Security http://msdn.microsoft.com/en-us/library/ee336235.aspx General Security for SQL Azure http://msdn.microsoft.com/en-us/library/ff394108.aspx Backup and Recovery http://social.technet.microsoft.com/wiki/contents/articles/sql-azure-backup-and-restore-strategy.aspx More Backup and Recovery Options http://social.technet.microsoft.com/wiki/contents/articles/current-options-for-backing-up-data-with-sql-azure.aspx Syncing Large Databases to SQL Azure http://blogs.msdn.com/b/sync/archive/2010/09/24/how-to-sync-large-sql-server-databases-to-sql-azure.aspx Programming Programming Patterns and Architectures for SQL Azure systems. How to Build and Manage a Business Database on SQL Azure http://tinyurl.com/25q5v6g Connection Management http://social.technet.microsoft.com/wiki/contents/articles/sql-azure-connection-management-in-sql-azure.aspx Transact-SQL Supported by SQL Azure http://msdn.microsoft.com/en-us/library/ee336250.aspx

    Read the article

  • C# 5.0 Async/Await Demo Code

    - by Paulo Morgado
    I’ve published the sample code I use to demonstrate the use of async/await in C# 5.0. You can find it here. Projects PauloMorgado.AyncDemo.WebServer This project is a simple web server implemented as a console application using Microsoft ASP.NET Web API self hosting and serves an image (with a delay) that is accessed by the other projects. This project has a dependency on Json.NET due to the fact the the Microsoft ASP.NET Web API hosting has a dependency on Json.NET. The application must be run on a command prompt with administrative privileges or a urlacl must be added to allow the use of the following command: netsh http add urlacl url=http://+:9090/ user=machine\username To remove the urlacl, just use the following command: netsh http delete urlacl url=http://+:9090/ PauloMorgado.AsyncDemo.WindowsForms This Windows Forms project contains three regions that must be uncommented one at a time: Sync with WebClient This code retrieves the image through a synchronous call using the WebClient class. Async with WebClient This code retrieves the image through an asynchronous call using the WebClient class. Async with HttpClient with cancelation This code retrieves the image through an asynchronous call with cancelation using the HttpClient class. PauloMorgado.AsyncDemo.Wpf This WPF project contains three regions that must be uncommented one at a time: Sync with WebClient This code retrieves the image through a synchronous call using the WebClient class. Async with WebClient This code retrieves the image through an asynchronous call using the WebClient class. Async with HttpClient with cancelation This code retrieves the image through an asynchronous call with cancelation using the HttpClient class.

    Read the article

  • Loss of iPod nano connection via VirtualBox and iTunes

    - by user69245
    I use VirtualBox 4.12 with Ubuntu 12.04, and up until a couple of days ago I was able to sync my iPod nano, my iPod Classic and my iPad via Windows XP and iTunes. A few days ago, when I connected the iPod nano, iTunes told me it was in recovery and I'd have to Restore it. I did this, but when it started up again I was told it was still in recovery. I went through this loop a few times, and then I got it to work again, and synched successfully. Since then, I have been unable to sync my iPod nano, although both iPod Classic and iPad work fine. I have successfully synched the iPod on a laptop with Windows XP since then, but each time I connect it through VirtualBox I get the same error message. I have tried disabling the iPod service in (the VirtualBox version of) Windows, and find that the iPod isn't being mounted as a disc drive, which is what happens in Ubuntu, and on my Windows XP laptop. I've tried changing USB leads, and I've also booted Windows XP on my Ubuntu machine, and here iTunes recognises the iPod nano. As far as I know, I made no changes to the configuration of VirtualBox between the time it was synching satisfactorily and the time it failed. I don't think iTunes is at fault here, as the same version of iTunes syncs with the iPod nano on two different computers running Windows XP - I think it may be the way XP running in VirtualBox handles the mounting of the iPod. Any suggestions?

    Read the article

  • ubuntu one not syncing

    - by Martin
    I am really starting to despair as I have been trying ubuntu one for several months, trying it on several machines, and it has caused me loads of different issues wasting me a lot of time. It is not straight forward to use, it should be a piece of software that runs in background and users should not think about checking all the time if it is really doing it's job. Of course I have been searching around this website and other forums but couldn't find an answer to my situation. Yesterday I had several problems with the client not syncing and using a lot of the machine's RAM, up and CPU. I had to reboot on several occasions and leave the office's PC on overnight in order to sync a few files of not more than a few MB. Today I am experiencing another problem: I have decided to do a test putting a small file in my ubuntu one shared folder. Ubuntu one is not detecting it (now already more than an hour), therefore not uploading it to the server. martin@ubuntu-desktop:~$ u1sdtool --status State: QUEUE_MANAGER connection: With User With Network description: processing the commands pool is_connected: True is_error: False is_online: True queues: IDLE and martin@ubuntu-desktop:~$ u1sdtool --current-transfers Current uploads: 0 Current downloads: 0 I am running Ubuntu 11.04 64 with all recent updates. On my other machine the transfer of files seems to be completely frozen, with around 10 files in the queue but no transfer whatsoever. Another curious issue is on my Ubuntu 10.10 laptop where ubuntu one seems to have completly disappeared from Nautilus context menu, folder/file sync status icons missing. I have therefore been forced to upgrade to 11.04 on this machine. Anyway, now I would like to solve the ** processing the commands pool ** issue and make sure the client

    Read the article

  • Multiple computers on Ubuntu One

    - by L R Bellmore Jr
    I have added files from 4 computers to Ubuntu One. One computer failed. What happens to the files that I uploaded. Are they still on Ubuntu One? How come when I upload a file from computer A, computer B with the same Ubuntu One account does not sync and load that file into computer B - That has created this question.. what happens to files from computers from which I uploaded documents when those computers are no longer active or failed, or no longer have Ubuntu One on that computer from which the files were uploaded... Have I lost the files? The followup question is how come files from Computer A uploaded to Ubuntu One don't sync to Computer B. That is a related question. I need to shut down a computer, reformat the hard drive and install Linux on the entire harddrive instead of a dual boot with Windows XP as I am going to use Virtual Machines instead.. what happens to the files from the Windows Dual Boot that were uploaded to Ubuntu One? Are they removed from Ubuntu One and then have I lost those files if I don't backup to another service first.

    Read the article

< Previous Page | 714 715 716 717 718 719 720 721 722 723 724 725  | Next Page >