Search Results

Search found 24721 results on 989 pages for 'int tostring'.

Page 762/989 | < Previous Page | 758 759 760 761 762 763 764 765 766 767 768 769  | Next Page >

  • Change LINQ2SQL property in partial class?

    - by Fermin
    Hi, I have a table in my LINQ2SQL diagram with a column called DayOfWeek in table JourneyBooking. The designer.cs has the definition of this as: [Column(Storage="_DayOfWeek", DbType="TinyInt NOT NULL")] public int DayOfWeek { get { return this._DayOfWeek; } set { if ((this._DayOfWeek != value)) { this.OnDayOfWeekChanging(value); this.SendPropertyChanging(); this._DayOfWeek = value; this.SendPropertyChanged("DayOfWeek"); this.OnDayOfWeekChanged(); } } } I have a partial class for the JourneyBooking class. Is it possible to extend/overwrite the above DayOfWeek property with my own property? The issue I am having is that DayOfWeek is 0-6 in C# but 1-7 in SQL, so I was thinking that I could overwrite the DayOfWeek property to subtract or add 1 depending on whether it was a get or set, is this possible or would I need to re-write all of the above code in my partial class?

    Read the article

  • Default Accessor Needed: Custom ConfigurationSection

    - by Mark
    I am totally confused by a simple Microsoft error message. When I run XSD.exe against an assembly that contains a custom ConfigurationSection (which in turn utilizes a custom ConfigurationElement and a custom ConfigurationElementCollection, as well as several ConfigurationProperties), I get the following error message: Error: There was an error processing 'Olbert.Entity.Utils.dll'. There was an error reflecting type 'Olbert.Entity.DatabaseConnection'. You must implement a default accessor on System.Configuration.ConfigurationLockCollection because it inherits from ICollection. Yet the class in question has a default accessor: public object this[int idx] { get { return null; } set { } } I realize the above doesn't do anything, but I don't need to access the element's properties by index. I'm just trying to work around the error message. So what's going on?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Variadic functions and arguments assignment in C/C++

    - by Rizo
    I was wondering if in C/C++ language it is possible to pass arguments to function in key-value form. For example in python you can do: def some_function(arg0 = "default_value", arg1): # (...) value1 = "passed_value" some_function(arg1 = value1) So the alternative code in C could look like this: void some_function(char *arg0 = "default_value", char *arg1) { ; } int main() { char *value1 = "passed_value"; some_function(arg1 = value1); return(0); } So the arguments to use in some_function would be: arg0 = "default_value" arg1 = "passed_value" Any ideas?

    Read the article

  • Implements an Undo/Redo in MVC

    - by bnabilos
    Hello, I have a Java application and I want to implement an Undo/Redo option. the value that I want to stock and that I want to be able to recover is an integer. My Class Model implements the interface StateEditable and I have to redefine the 2 functions restoreState(Hashtable<?, ?> state) and storeState(Hashtable<Object, Object> state) but I don't know what to put on them. It will be really great if somebody can help me to do that. These are the first lines of my Model class, the value that I want to do an undo/redo on it is value public class Model extends Observable implements StateEditable { private int value = 5; private UndoManager undoRedo = new UndoManager(); final UndoableEditListener editListener = new UndoableEditListener() { public void undoableEditHappened(UndoableEditEvent evt) { undoRedo.addEdit(evt.getEdit()); } }; @Override public void restoreState(Hashtable<?, ?> state) { } @Override public void storeState(Hashtable<Object, Object> state) { } }

    Read the article

  • Passing a comparator syntax help in Java

    - by Crystal
    I've tried this a couple ways, the first is have a class that implements comparator at the bottom of the following code. When I try to pass the comparat in sortListByLastName, I get a constructor not found error and I am not sure why import java.util.*; public class OrganizeThis implements WhoDoneIt { /** Add a person to the organizer @param p A person object */ public void add(Person p) { staff.put(p.getEmail(), p); //System.out.println("Person " + p + "added"); } /** * Remove a Person from the organizer. * * @param email The email of the person to be removed. */ public void remove(String email) { staff.remove(email); } /** * Remove all contacts from the organizer. * */ public void empty() { staff.clear(); } /** * Find the person stored in the organizer with the email address. * Note, each person will have a unique email address. * * @param email The person email address you are looking for. * */ public Person findByEmail(String email) { Person aPerson = staff.get(email); return aPerson; } /** * Find all persons stored in the organizer with the same last name. * Note, there can be multiple persons with the same last name. * * @param lastName The last name of the persons your are looking for. * */ public Person[] find(String lastName) { ArrayList<Person> names = new ArrayList<Person>(); for (Person s : staff.values()) { if (s.getLastName() == lastName) { names.add(s); } } // Convert ArrayList back to Array Person nameArray[] = new Person[names.size()]; names.toArray(nameArray); return nameArray; } /** * Return all the contact from the orgnizer in * an array sorted by last name. * * @return An array of Person objects. * */ public Person[] getSortedListByLastName() { PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(comp); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; } private Map<String, Person> staff = new HashMap<String, Person>(); public static void main(String[] args) { OrganizeThis testObj = new OrganizeThis(); Person person1 = new Person("J", "W", "111-222-3333", "[email protected]"); Person person2 = new Person("K", "W", "345-678-9999", "[email protected]"); Person person3 = new Person("Phoebe", "Wang", "322-111-3333", "[email protected]"); Person person4 = new Person("Nermal", "Johnson", "322-342-5555", "[email protected]"); Person person5 = new Person("Apple", "Banana", "123-456-1111", "[email protected]"); testObj.add(person1); testObj.add(person2); testObj.add(person3); testObj.add(person4); testObj.add(person5); System.out.println(testObj.findByEmail("[email protected]")); System.out.println("------------" + '\n'); Person a[] = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("------------" + '\n'); a = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("SORTED" + '\n'); a = testObj.getSortedListByLastName(); for (Person b : a) { System.out.println(b); } System.out.println(testObj.getAuthor()); } } class PersonLastNameComparator implements Comparator<Person> { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } } And then when I tried doing it by creating an anonymous inner class, I also get a constructor TreeMap cannot find symbol error. Any thoughts? inner class method: public Person[] getSortedListByLastName() { //PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(new Comparator<Person>() { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } }); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; }

    Read the article

  • LINQ-to-SQL and SQL Compact - database file sharing problem

    - by Eye of Hell
    Hello. I'm learing LINQ-to-SQL right now and i have wrote a simple application that define SQL data: [Table( Name = "items" )] public class Item { [ Column( IsPrimaryKey = true, IsDbGenerated = true ) ] public int Id; [ Column ] public string Name; } I have launched 2 copy of application connected to the same .sdf file and tested if all database modifications in one application affects another application. But strange thing arise. If i use InsertOnSubmit() and DeleteOnSubmit() in one application, added/removed items are instantly visible in other application via 'select' LINQ queue. But if i try to modify 'Name' field in one application, it is NOT visible in other applicaton until it reconnects the database :(. The test code i use: var Items = from c in db.Items where Id == c.Id select c; foreach( var Item in Items ) { Item.Name = "new name"; break; } db.SubmitChanges(); Can anyone suggest what i'm doing wrong and why InsertOnSubmit()/DeleteOnSubmit works and SubmitChanges() don't?

    Read the article

  • IStatelessSession insert object with many-to-one

    - by Andrew Kalashnikov
    Hello guys. I've got common mapping <class name="NotSyncPrice, Portal.Core" table='Not_sync_price'> <id name="Id" unsaved-value="0"> <column name="id" not-null="true"/> <generator class="native"/> </id> <many-to-one name="City" class="Clients.Core.Domains.City, Clients.Core" column="city_id" cascade="none"></many-to-one> <!--<property name="City"> <column name="city_id"/> </property>--> I want to use IStatelessSession for batch insert. But when i set city object to NotSyncPrice object and call IStatelessSession I've got strange exception: NHibernate.Impl.StatelessSessionImpl.get_Timestamp() When its null or int all is ok. I try use real && proxy city object. But no result. What's wrong:( Please help

    Read the article

  • Location of the fonts on the iPhone?

    - by Kyle
    I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

    Read the article

  • Call method with parameters after animation completion

    - by Jean
    I want to call a method with certain parameters once an animation is done. The flow is something like this: -(void) myMethod:(int)val { [self performAnimation]; [self doSomethingElse:val]; // This should be done after animation completion } I presume the 'doSomethingElse' method needs to be called from the method defined in 'setAnimationDidStopSelector' - or is there a way to have the animation block until done? What is the best way to let the method called on 'setAnimationDidStopSelector' know about the method it needs to call and its parameter? Can this be done with selectors? Or is the only way of doing this by storing the methods and its params in class temp variables and access them when needed?

    Read the article

  • T-SQL Table Variable Creating PHYSICAL Table!

    - by Mike
    OMG! What am I doing wrong? declare @WTF TABLE ( OrderItemId int ) SELECT TOP 20 OrderItemId as OrderItemId INTO [@WTF] FROM ac_OrderItems SELECT * FROM [@WTF] Problem A: This creates a PHYSICAL table called @WTF. WHY?? I thought this was in memory only?! Problem B: The last line of code, if I do select * from @WTF... WITHOUT the [ ], it returns NOTHING. What is the significance of the [ ]? I need serious help. I'm losing my MIND! Thanks in advance.

    Read the article

  • getline() returns empty line in Eclipse but working properly in Dev C++

    - by pocoa
    Here is my code: #include <iostream> #include <stdlib.h> #include <fstream> using namespace std; int main() { string line; ifstream inputFile; inputFile.open("input.txt"); do { getline(inputFile, line); cout << line << endl; } while (line != "0"); return 0; } input.txt content: 5 9 2 9 3 8 2 8 2 1 0 In Enclipse, it goes to infinite-loop. I'm using MinGW 5.1.6 + Eclipse CDT. I tried many things but I couldn't find the problem.

    Read the article

  • Problem with migrating a model in ruby

    - by Shreyas Satish
    I run script/generate model query edit query.rb in models.. class Query < ActiveRecord::Base #I even tried Migrations instead of Base def sef.up create table :queries do|t| t.string :name end end def self.down drop_table :queries end end ,run rake db:migrate. and what I see in db is this: mysql> desc queries; +------------+----------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+----------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | created_at | datetime | YES | | NULL | | | updated_at | datetime | YES | | NULL | | +------------+----------+------+-----+---------+----------------+ Where is the "name" field? HELP ! Cheers !

    Read the article

  • Android v1.5 w/ browser data storage

    - by Sirber
    I'm trying to build an offline web application which can sync online if the network is available. I tryed jQuery jStore but the test page stop at "testing..." whitout result, then I tryed Google Gears which is supposed to be working on the phone but it gears is not found. if (window.google && google.gears) { google.gears.factory.getPermission(); // Database var db = google.gears.factory.create('beta.database'); db.open('cominar-compteurs'); db.execute('create table if not exists Lectures' + ' (ID_COMPTEUR int, DATE_HEURE timestamp, kWh float, Wmax float, VAmax float, Wcum float, VAcum float);'); } else { alert('Google Gears non trouvé.'); } the code does work on Google Chrome v5.

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • Cocos2D TouchesEnded not allowing me to access sprites?

    - by maiko
    Hey Guys! Thanks so much for reading! - (void)ccTouchesEnded:(NSSet *)touches withEvent:(UIEvent *)event { UITouch * touch = [touches anyObject]; CGPoint location = [[CCDirector sharedDirector] convertToGL: [touch locationInView:touch.view]]; CGRect myRect = CGRectMake(100, 120, 75, 113); int tjx = sprite.position.x; if(CGRectContainsPoint(myRect, location)) { tjx ++; } } For some reason, ccTouchesEnded isn't allowing me to access my "sprite". I also tried to use CGRectMake like so : CGRectMake( sprite.position.x, sprite.position.y, sprite.contentSize.Width, sprite.contentSize.Height) But I couldn't access my sprites position or height. I keep getting "sprite" undeclared when it is declared in the init method, and added to the child. Please help!! I'm sure i'm missing something really simple here.

    Read the article

  • is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

    - by lucid
    first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

    Read the article

  • LINQ: How to Use RemoveAll without using For loop with Array

    - by CrimsonX
    I currently have a log object I'd like to remove objects from, based on a LINQ query. I would like to remove all records in the log if the sum of the versions within a program are greater than 60. Currently I'm pretty confident that this'll work, but it seems kludgy: for (int index = 0; index < 4; index++) { Log.RemoveAll(log => (log.Program[index].Version[0].Value + log.Program[index].Version[1].Value + log.Program[index].Version[2].Value ) > 60); } The Program is an array of 4 values and version has an array of 3 values. Is there a more simple way to do this RemoveAll in LINQ without using the for loop? Thanks for any help in advance!

    Read the article

  • Java Annotations - Is there any helper library to read/process annotations?

    - by mjlee
    I start to use Java annotations heavily. One example is taking method with annotations and converting them into 'telnet'-based command-line command. I do this by parsing annotations and hook into jopt option parser. However, I do a lot of these manually. For example, Method parameter annotation processing.. Method method = ... //; Class[] parameters = method.getParamterTypes(); Annotation[][] annotations = method.getparamterAnnotations(); for( int i = 0; i < parameters.length; i++ ) { // iterate through the annotation , see if each param has specific annotation ,etc. } It is very redundant and tedious. Is there any opensource project that help processing Annotations?

    Read the article

  • MySQL ignores the NOT NULL constraint

    - by Marga Keuvelaar
    I have created a table with NOT NULL constraints on some columns in MySQL. Then in PHP I wrote a script to insert data, with an insert query. When I omit one of the NOT NULL columns in this insert statement I would expect an error message from MySQL, and I would expect my script to fail. Instead, MySQL inserts empty strings in the NOT NULL fields. In other omitted fields the data is NULL, which is fine. Could someone tell me what I did wrong here? I'm using this table: CREATE TABLE IF NOT EXISTS tblCustomers ( cust_id int(11) NOT NULL AUTO_INCREMENT, custname varchar(50) NOT NULL, company varchar(50), phone varchar(50), email varchar(50) NOT NULL, country varchar(50) NOT NULL, ... date_added timestamp NOT NULL DEFAULT CURRENT_TIMESTAMP, PRIMARY KEY (cust_id) ) ; And this insert statement: $sql = "INSERT INTO tblCustomers (custname,company) VALUES ('".$customerName."','".$_POST["CustomerCompany"]."')"; $res = mysqli_query($mysqli, $sql);

    Read the article

  • Get the address from the contacts.

    - by KKC
    can someone help me with the following code to get the address stored from the contact?? THANK YOU! // Extract the address. String where = ContactsContract.ContactMethods.PERSON_ID + " == " + id + " AND " + ContactsContract.ContactMethods.KIND + " == " + ContactsContract.KIND_POSTAL; addressCursor = context.getContentResolver().query(ContactsContract.ContactMethods.CONTENT_URI, null, where, null, null); // Extract the postal address from the cursor int postalAddress = addressCursor.getColumnIndexOrThrow(ContactsContract.ContactMethodsColumns.DATA); String address = ""; if (addressCursor.moveToFirst()) address = addressCursor.getString(postalAddress); addressCursor.close();

    Read the article

  • jtextfield keyevent handling issue

    - by vamsi
    doesn't .getKeyCode( ) return the key's int value? Because i have set my jtextfield to listen to keylistener, and in the keytyped method, i check what key has been pressed. Here's a snippet of my code: JTextField jtf = new JTextField( ); jtf.addKeyListener( this ); . . . public void keyTyped( KeyEvent e ) { if( e.getKeyCode( ) == KeyEvent.VK_ENTER ) System.out.println( "pressed enter" ); } but everytime i type enter in the jtextfield, nothing happens, ie nothing prints.

    Read the article

  • Template metaprogram converting type to unique number

    - by daramarak
    I just started playing with metaprogramming and I am working on different tasks just to explore the domain. One of these was to generate a unique integer and map it to type, like below: int myInt = TypeInt<AClass>::value; I want to know if this is at all possible, and in that case how. Because although I have learned much about exploring this subject I still have failed to come up with an answer. (P.S. A yes/no answer is much more gratifying than a c++ solution that doesn't use metaprogramming, as this is the domain that I am exploring)

    Read the article

  • Problem with starting OpenOffice service (soffice) from Java (command working in commandline, but no

    - by Shervin
    I want to exceute a simple command which works from the shell but doesn't work from Java. This is the command I want to execute, which works fine: soffice -headless "-accept=socket,host=localhost,port=8100;urp;" This is the code I am excecuting from Java trying to run this command: String[] commands = new String[] {"soffice","-headless","\"-accept=socket,host=localhost,port=8100;urp;\""}; Process process = Runtime.getRuntime().exec(commands) int code = process.waitFor(); if(code == 0) System.out.println("Commands executed successfully"); When I run this program I get "Commands executed successfully". However the process is not running when the program finishes. Is it possible that the JVM kills the program after it has run? Why doesn't this work?

    Read the article

  • Using device variable by multiple threads on CUDA

    - by ashagi
    I am playing around with cuda. At the moment I have a problem. I am testing a large array for particular responses, and when I get the response, I have to copy the data onto another array. For example, my test array of 5 elements looks like this: [ ][ ][v1][ ][ ][v2] Result must look like this: [v1][v2] The problem is how do I calculate the address of the second array to store the result? All elements of the first array are checked in parallel. I am thinking to declare a device variable int addr = 0. Every time I find a response, I will increment the addr. But I am not sure about that because it means that addr may be accessed by multiple threads at the same time. Will that cause problems? Or will the thread wait until another thread finishes using that variable?

    Read the article

< Previous Page | 758 759 760 761 762 763 764 765 766 767 768 769  | Next Page >