Search Results

Search found 19967 results on 799 pages for 'document template'.

Page 791/799 | < Previous Page | 787 788 789 790 791 792 793 794 795 796 797 798  | Next Page >

  • Toggle visibility of DIV based on Dropdown

    - by user1869787
    I have never used Javascript before, only HTML and CSS. I am attempting to have my information show only when selected from my drop down. I don't know any Javascript so any help would be overly appreciated. This is my html so far: <!DOCTYPE HTML> <html> <head> <meta charset="utf-8" /> <title>Gone Fishin'</title> <link href="finale.css" rel="stylesheet" type="text/css"> </head> <div id="wrapper"> <div id="nav"> <ul> <li><a href="Index.html">About Us</a></li> <li><a href="Species.html">List by Species</a></li> <li><a href="County.html">List by County</a></li> <li><a href="apply.html">Reservations</a></li> </ul> </div> <body> <div id="content"> <p>ontent</p> <fieldset> <legend>Choose your Target</legend> <select name="option" id="options"> <option value=""></option> <option value="1">American Shad</option> <option value="2">Black Crappie</option> <option value="3">Bluegill</option> <option value="4">Brook Trout</option> <option value="5">Brown Trout</option> <option value="6">Carp</option> <option value="7">Chain Pickerel</option> <option value="8">Channel Catfish</option> <option value="9">Flathead Catfish</option> <option value="10">Largemouth Bass</option> <option value="11">Muskellunge</option> <option value="12">Norhtern Pike</option> <option value="13">Pumkpinseed</option> <option value="14">Rainbow Trout</option> <option value="15">Readbreast Sunfish</option> <option value="16">Rock Bass</option> <option value="17">Sauger</option> <option value="18">Saugeye</option> <option value="19">Smallmouth Bass</option> <option value="20">Steelhead</option> <option value="21">Striped Bass</option> <option value="22">Walleye</option> <option value="23">White Bass</option> <option value="24">White Crappie</option> <option value="25">White Perch</option> <option value="26">Yellow Perch</option> </select> <div id="option"> <div id="1" style="display: block">Test 1</div> <div id="2">Test 2</div> <div id="3">Test 3</div> <div id="4">Test 4</div> <div id="5">Test 5</div> </div> </fieldset> </div> </body> </div> </html> And this is my CSS: @charset "utf-8"; /* CSS Document */ /*General Styles*/ * {font-family:Verdana, Geneva, sans-serif;} #wrapper {width:85%; margin:auto; background-color:#00CC00;} /*End of General Styles*/ /* nav div styles */ #nav {background-color:#FF0000; text-align:center;} #nav ul li {display:inline-block; background-color: #67e667; border:5px dashed; width: 90px text-align:center;} #nav ul li a:link {background-color:#a60000; width: 90px;} #nav ul li a:visited {background-color: #009999;} #nav ul li a:hover {background-color: #a64b00;} /* end nav styles */ /* content div styles*/ #content {padding: 5px;} #option {display:none;} /*end content styles*/ /*start form styles*/ fieldset {background-color:#ff7400; color:white} label {display:inline-block; width: 150px; float:left; margin-right: 3px;} #form li{margin-bottom:10px;} #dtg li{margin-bottom:5px;} Thank you for any help received

    Read the article

  • Need help debugging a PHP 5 SOAP hello world application

    - by WarDoGG
    I've been trying to get PHP 5 SOAP extension to work after reading every tutorial there is on the web, but to no avail. This has been very frustrating and i would really appreciate it if someone could point out where i am going wrong and why. Thanks for your help in advance, and any more details needed i'll oblige. The WSDL is as follows : <?xml version="1.0" encoding="utf-8"?> <wsdl:definitions name="test" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tm="http://microsoft.com/wsdl/mime/textMatching/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/" xmlns:mime="http://schemas.xmlsoap.org/wsdl/mime/" xmlns:tns="http://tempuri.org/" xmlns:s1="http://microsoft.com/wsdl/types/" xmlns:s="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://schemas.xmlsoap.org/wsdl/soap12/" xmlns:http="http://schemas.xmlsoap.org/wsdl/http/" targetNamespace="http://tempuri.org/" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/"> <wsdl:types> <s:schema elementFormDefault="qualified" targetNamespace="http://tempuri.org/"> <s:import namespace="http://microsoft.com/wsdl/types/" /> <s:element name="getUser"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="username" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="password" type="s:string" /> </s:sequence> </s:complexType> </s:element> <s:element name="getUserResponse"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="getUserResult" type="tns:bookUser" /> </s:sequence> </s:complexType> </s:element> <s:complexType name="bookUser"> <s:sequence> <s:element minOccurs="1" maxOccurs="1" name="ID" type="s:int" /> <s:element minOccurs="1" maxOccurs="1" name="GUID" type="s1:guid" /> <s:element minOccurs="0" maxOccurs="1" name="login" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="pass" type="s:string" /> </s:sequence> </s:complexType> </s:schema> </wsdl:types> <wsdl:message name="getUserSoapIn"> <wsdl:part name="parameters" element="tns:getUser" /> </wsdl:message> <wsdl:message name="getUserSoapOut"> <wsdl:part name="parameters" element="tns:getUserResponse" /> </wsdl:message> <wsdl:portType name="test"> <wsdl:operation name="getUser"> <wsdl:input message="tns:getUserSoapIn" /> <wsdl:output message="tns:getUserSoapOut" /> </wsdl:operation> </wsdl:portType> <wsdl:binding name="testBinding" type="tns:test"> <soap:binding style="document" transport="http://schemas.xmlsoap.org/soap/http" /> <wsdl:operation name="getUser"> <soap:operation soapAction="http://tempuri.org/getUser" /> <wsdl:input> <soap:body use="literal" /> </wsdl:input> <wsdl:output> <soap:body use="literal" /> </wsdl:output> </wsdl:operation> </wsdl:binding> <wsdl:service name="testService"> <wsdl:port name="testPort" binding="tns:testBinding"> <soap:address location="http://127.0.0.1/index.php" /> </wsdl:port> </wsdl:service> </wsdl:definitions> The code for the server : <?php function getUser($param) { return array( 'bookUser'=>array ( 'ID'=>1, 'GUID'=>2, 'login'=>$param->username, 'pass'=>$param->password ) ); } ini_set("soap.wsdl_cache_enabled", "0"); // disabling WSDL cache $server = new SoapServer("http://127.0.0.1/1.wsdl"); $server->addFunction("getUser"); $server->handle(); ?> and the code for the client : $client = new SoapClient("http://127.0.0.1/index.php?wsdl", array('exceptions' => 0)); try { $arr_data = array ( array ( 'username'=>'xyz', 'password'=>'abc' ) ); print_r($client->__soapCall("getUser",$arr_data)); } catch (SoapFault $result) { print_r($result); }

    Read the article

  • Job conditions conflicting with personal principles on software-development - how much is too much?

    - by Baelnorn
    Sorry for the incoming wall'o'text (and for my probably bad English) but I just need to get this off somehow. I also accept that this question will be probably closed as subjective and argumentative, but I need to know one thing: "how much BS are programmers supposed to put up with before breaking?" My background I'm 27 years old and have a B.Sc. in Computer engineering with a graduation grade of 1.8 from a university of applied science. I went looking for a job right after graduation. I got three offers right away, with two offers paying vastly more than the last one, but that last one seemed more interesting so I went for that. My situation I've been working for the company now for 17 months now, but it feels like a drag more and more each day. Primarily because the company (which has only 5 other developers but me, and of these I work with 4) turned out to be pretty much the anti-thesis of what I expected (and was taught in university) from a modern software company. I agreed to accept less than half of the usual payment appropriate for my qualification for the first year because I was promised a trainee program. However, the trainee program turned out to be "here you got a computer, there's some links on the stuff we use, and now do what you colleagues tell you". Further, during my whole time there (trainee or not) I haven't been given the grace of even a single code-review - apparently nobody's interested in my work as long as it "just works". I was told in the job interview that "Microsoft technology played a central role in the company" yet I've been slowly eroding my congnitive functions with Flex/Actionscript/Cairngorm ever since I started (despite having applied as a C#/.NET developer). Actually, the company's primary projects are based on Java/XSLT and Flex/Actionscript (with some SAP/ABAP stuff here and there but I'm not involved in that) and they've been working on these before I even applied. Having had no experience either with that particular technology nor the framework nor the field (RIA) nor in developing business scale applications I obviously made several mistakes. However, my boss told me that he let me make those mistakes (which ate at least 2 months of development time on their own) on purpose to provide some "learning experience". Even when I was still a trainee I was already tasked with working on a business-critical application. On my own. Without supervision. Without code-reviews. My boss thinks agile methods are a waste of time/money and deems putting more than one developer on any project not efficient. Documentation is not necessary and each developer should only document what he himself needs for his work. Recently he wanted us to do bug tracking with Excel and Email instead of using an already existing Bugzilla, overriding an unanimous decision made by all developers and testers involved in the process - only after another senior developer had another hour-long private discussion with him he agreed to let us use the bugtracker. Project management is basically not present, there are only a few Excel sheets floating around where the senior developer lists some things (not all, mind you) with a time estimate ranging from days to months, trying to at least somehow organize the whole mess. A development process is also basically not present, each developer just works on his own however he wants. There are not even coding conventions in the company. Testing is done manually with a single tester (sometimes two testers) per project because automated testing wasn't given the least thought when the whole project was started. I guess it's not a big surprise when I say that each developer also has his own share of hundreds of overhours (which are, of course, unpaid). Each developer is tasked with working on his own project(s) which in turn leads to a very extensive knowledge monopolization - if one developer was to have an accident or become ill there would be absolutely no one who could even hope to do his work. Considering that each developer has his own business-critical application to work on, I guess that's a pretty bad situation. I've been trying to change things for the better. I tried to introduce a development process, but my first attempt was pretty much shot down by my boss with "I don't want to discuss agile methods". After that I put together a process that at least resembled how most of the developers were already working and then include stuff like automated (or at least organized) testing, coding conventions, etc. However, this was also shot down because it wasn't "simple" enought to be shown on a business slide (actually, I wasn't even given the 15 minutes I'd have needed to present the process in the meeting). My problem I can't stand working there any longer. Seriously, I consider to resign on monday, which still leaves me with 3 months to work there due to the cancelation period. My primary goal since I started studying computer science was being a good computer scientist, working with modern technologies and adhering to modern and proven principles and methods. However, the company I'm working for seems to make that impossible. Some days I feel as if was living in a perverted real-life version of the Dilbert comics. My question Am I overreacting? Is this the reality each graduate from university has to face? Should I betray my sound principles and just accept these working conditions? Or should I gtfo of there? What's the opinion of other developers on this matter. Would you put up with all that stuff?

    Read the article

  • Conditional Validation using JQuery Validation Plugin

    - by Steve Kemp
    I have a simple html form that I've added validation to using the JQuery Validation plugin. I have it working for single fields that require a value. I now need to extend that so that if a user answers Yes to a question they must enter something in the Details field, otherwise the Details field can be left blank. I'm using radio buttons to display the Yes/No. Here's my complete html form - I'm not sure where to go from here: <script type="text/javascript" charset="utf-8"> $.metadata.setType("attr", "validate"); $(document).ready(function() { $("#editRecord").validate(); }); </script> <style type="text/css"> .block { display: block; } form.cmxform label.error { display: none; } </style> </head> <body> <div id="header"> <h1> Questions</h1> </div> <div id="content"> <h1> Questions Page 1 </h1> </div> <div id="content"> <h1> </h1> <form class="cmxform" method="post" action="editrecord.php" id="editRecord"> <input type="hidden" name="-action" value="edit"> <h1> Questions </h1> <table width="46%" class="record"> <tr> <td width="21%" valign="top" class="field_name_left"><p>Question 1</p></td> <td width="15%" valign="top" class="field_data"> <label for="Yes"> <input type="radio" name="Question1" value="Yes" validate = "required:true" /> Yes </label> <label for="No"> <input type="radio" name="Question1" value="No" /> No </label> <label for="Question1" class="error">You must answer this question to proceed</label> </td> <td width="64%" valign="top" class="field_data"><strong>Details:</strong> <textarea id = "Details1" class="where" name="Details1" cols="25" rows="2"></textarea></td> </tr> <tr> <td valign="top" class="field_name_left">Question 2</td> <td valign="top" class="field_data"> <label for="Yes"> <input type="radio" name="Question2" value="Yes" validate = "required:true" /> Yes </label> <label for="No"> <input type="radio" name="Question2" value="No" /> No </label> <label for="Question2" class="error">You must answer this question to proceed</label> </td> <td valign="top" class="field_data"><strong>Details:</strong> <textarea id = "Details2" class="where" name="Details2" cols="25" rows="2"></textarea> </td> </tr> <tr class="submit_btn"> <td colspan="3"> <input type="submit" name="-edit" value="Finish"> <input type="reset" name="reset" value="Reset"> </td> </tr> </table> </form> </div> </body> </html>

    Read the article

  • HTML + javascript mouse over, mouseout, onclick not working in firefox.

    - by help_inmssql
    Hello Everyone, My question is to get onMouseover,onMouseout,onMousedown,onClick on a table row. For which i am calling javascript userdefined functions. onMouseover --- Background color should change. onMouseout --- Reset to original color onClick --- First column checkbox/radio button should be set and background color should change onMousedown --- background color should change. My code in html is:- <tr onMouseOver="hover(this)" onMouseOut="hover_out(this)" onMouseDown="get_first_state(this)" onClick="checkit(this)" > and the methods in javascripts are:- var first_state = false; var oldcol = '#ffffff'; var oldcol_cellarray = new Array(); function hover(element) { if (! element) element = this; while (element.tagName != 'TR') { element = element.parentNode; } if (element.style.fontWeight != 'bold') { for (var i = 0; i<element.cells.length; i++) { if (element.cells[i].className != "no_hover") { oldcol_cellarray[i] = element.cells[i].style.backgroundColor; element.cells[i].style.backgroundColor='#e6f6f6'; } } } } // ----------------------------------------------------------------------------------------------- function hover_out(element) { if (! element) element = this; while (element.tagName != 'TR') { element = element.parentNode; } if (element.style.fontWeight != 'bold') { for (var i = 0; i<element.cells.length; i++) { if (element.cells[i].className != "no_hover") { if (typeof oldcol_cellarray != undefined) { element.cells[i].style.backgroundColor=oldcol_cellarray[i]; } else { element.cells[i].style.backgroundColor='#ffffff'; } //var oldcol_cellarray = new Array(); } } } } // ----------------------------------------------------------------------------------------------- function get_first_state(element) { while (element.tagName != 'TR') { element = element.parentNode; } first_state = element.cells[0].firstChild.checked; } // ----------------------------------------------------------------------------------------------- function checkit (element) { while (element.tagName != 'TR') { element = element.parentNode; } if (element.cells[0].firstChild.type == 'radio') { var typ = 0; } else if (element.cells[0].firstChild.type == 'checkbox') { typ = 1; } if (element.cells[0].firstChild.checked == true && typ == 1) { if (element.cells[0].firstChild.checked == first_state) { element.cells[0].firstChild.checked = false; } set_rowstyle(element, element.cells[0].firstChild.checked); } else { if (typ == 0 || element.cells[0].firstChild.checked == first_state) { element.cells[0].firstChild.checked = true; } set_rowstyle(element, element.cells[0].firstChild.checked); } if (typ == 0) { var table = element.parentNode; if (table.tagName != "TABLE") { table = table.parentNode; } if (table.tagName == "TABLE") { table=table.tBodies[0].rows; //var table = document.getElementById("js_tb").tBodies[0].rows; for (var i = 1; i< table.length; i++) { if (table[i].cells[0].firstChild.checked == true && table[i] != element) { table[i].cells[0].firstChild.checked = false; } if (table[i].cells[0].firstChild.checked == false) { set_rowstyle(table[i], false); } } } } } function set_rowstyle(r, on) { if (on == true) { for (var i =0; i < r.cells.length; i++) { r.style.fontWeight = 'bold'; r.cells[i].style.backgroundColor = '#f2f2c2'; } } else { for ( i =0; i < r.cells.length; i++) { r.style.fontWeight = 'normal'; r.cells[i].style.backgroundColor = '#ffffff'; } } } It is working as expected in IE. But coming to firefox i am surprised on seeing the output after so much of coding. In Firefox:-- onMouseOver is working as expected. color change of that particular row. onClick -- Setting the background color permenantly..eventhough i do onmouseover on different rows. the clicked row color is not reset to white. -- not as expected onclick on 2 rows..the background of both the rows is set...not as expected i.e if i click on all the rows..background color of everything is changed... Eventhough i click on the row. First column i.e radio button or checkbox is not set.. Please help me to solve this issue in firefox. Do let me know where my code needs to be changed... Thanks in advance!!

    Read the article

  • How to hide jQuery Sub-Menus(ddsmoothmenu)?

    - by Tim
    I'm new to jQuery and i must admit that i've understood nothing yet, the syntax appears to me as an unknown language although i thought that i had my experiences with javascript. Nevertheless i managed it to implement this menu in my asp.net masterpage's header. Even got it to work that the content-page is loaded with ajax with help from here. But finally i'm failing with the menu to disappear when the new page was loaded asynchronously. I dont know how to hide this accursed jQuery Menu. Following the part of the js-file where the events are registered for hiding/disappearing. I dont know how to get the part that is responsible for it and even i dont know how to implement that part in my Anchor-onclick function where i dont have a reference to the jQuery Object. buildmenu:function($, setting){ var smoothmenu=ddsmoothmenu var $mainmenu=$("#"+setting.mainmenuid+">ul") //reference main menu UL $mainmenu.parent().get(0).className=setting.classname || "ddsmoothmenu" var $headers=$mainmenu.find("ul").parent() $headers.hover( function(e){ $(this).children('a:eq(0)').addClass('selected') }, function(e){ $(this).children('a:eq(0)').removeClass('selected') } ) $headers.each(function(i){ //loop through each LI header var $curobj=$(this).css({zIndex: 100-i}) //reference current LI header var $subul=$(this).find('ul:eq(0)').css({display:'block'}) $subul.data('timers', {}) this._dimensions={w:this.offsetWidth, h:this.offsetHeight, subulw:$subul.outerWidth(), subulh:$subul.outerHeight()} this.istopheader=$curobj.parents("ul").length==1? true : false //is top level header? $subul.css({top:this.istopheader && setting.orientation!='v'? this._dimensions.h+"px" : 0}) $curobj.children("a:eq(0)").css(this.istopheader? {paddingRight: smoothmenu.arrowimages.down[2]} : {}).append( //add arrow images '<img src="'+ (this.istopheader && setting.orientation!='v'? smoothmenu.arrowimages.down[1] : smoothmenu.arrowimages.right[1]) +'" class="' + (this.istopheader && setting.orientation!='v'? smoothmenu.arrowimages.down[0] : smoothmenu.arrowimages.right[0]) + '" style="border:0;" />' ) if (smoothmenu.shadow.enable){ this._shadowoffset={x:(this.istopheader?$subul.offset().left+smoothmenu.shadow.offsetx : this._dimensions.w), y:(this.istopheader? $subul.offset().top+smoothmenu.shadow.offsety : $curobj.position().top)} //store this shadow's offsets if (this.istopheader) $parentshadow=$(document.body) else{ var $parentLi=$curobj.parents("li:eq(0)") $parentshadow=$parentLi.get(0).$shadow } this.$shadow=$('<div class="ddshadow'+(this.istopheader? ' toplevelshadow' : '')+'"></div>').prependTo($parentshadow).css({left:this._shadowoffset.x+'px', top:this._shadowoffset.y+'px'}) //insert shadow DIV and set it to parent node for the next shadow div } $curobj.hover( function(e){ var $targetul=$subul //reference UL to reveal var header=$curobj.get(0) //reference header LI as DOM object clearTimeout($targetul.data('timers').hidetimer) $targetul.data('timers').showtimer=setTimeout(function(){ header._offsets={left:$curobj.offset().left, top:$curobj.offset().top} var menuleft=header.istopheader && setting.orientation!='v'? 0 : header._dimensions.w menuleft=(header._offsets.left+menuleft+header._dimensions.subulw>$(window).width())? (header.istopheader && setting.orientation!='v'? -header._dimensions.subulw+header._dimensions.w : -header._dimensions.w) : menuleft //calculate this sub menu's offsets from its parent if ($targetul.queue().length<=1){ //if 1 or less queued animations $targetul.css({left:menuleft+"px", width:header._dimensions.subulw+'px'}).animate({height:'show',opacity:'show'}, ddsmoothmenu.transition.overtime) if (smoothmenu.shadow.enable){ var shadowleft=header.istopheader? $targetul.offset().left+ddsmoothmenu.shadow.offsetx : menuleft var shadowtop=header.istopheader?$targetul.offset().top+smoothmenu.shadow.offsety : header._shadowoffset.y if (!header.istopheader && ddsmoothmenu.detectwebkit){ //in WebKit browsers, restore shadow's opacity to full header.$shadow.css({opacity:1}) } header.$shadow.css({overflow:'', width:header._dimensions.subulw+'px', left:shadowleft+'px', top:shadowtop+'px'}).animate({height:header._dimensions.subulh+'px'}, ddsmoothmenu.transition.overtime) } } }, ddsmoothmenu.showhidedelay.showdelay) }, function(e){ var $targetul=$subul var header=$curobj.get(0) clearTimeout($targetul.data('timers').showtimer) $targetul.data('timers').hidetimer=setTimeout(function(){ $targetul.animate({height:'hide', opacity:'hide'}, ddsmoothmenu.transition.outtime) if (smoothmenu.shadow.enable){ if (ddsmoothmenu.detectwebkit){ //in WebKit browsers, set first child shadow's opacity to 0, as "overflow:hidden" doesn't work in them header.$shadow.children('div:eq(0)').css({opacity:0}) } header.$shadow.css({overflow:'hidden'}).animate({height:0}, ddsmoothmenu.transition.outtime) } }, ddsmoothmenu.showhidedelay.hidedelay) } ) //end hover }) //end $headers.each() $mainmenu.find("ul").css({display:'none', visibility:'visible'}) } one link of my menu what i want to hide when the content is redirected to another page(i need "closeMenu-function"): <li><a href="DeliveryControl.aspx" onclick="AjaxContent.getContent(this.href);closeMenu();return false;">Delivery Control</a></li> In short: I want to fade out the submenus the same way they do automatically onblur, so that only the headermenu stays visible but i dont know how. Thanks, Tim EDIT: thanks to Starx' private-lesson in jQuery for beginners i solved it: I forgot the # in $("#smoothmenu1"). After that it was not difficult to find and call the hover-function from the menu's headers to let them fade out smoothly: $("#smoothmenu1").find("ul").hover(); Regards, Tim

    Read the article

  • How do I add the j2ee.jar to a Java2WSDL ant script programmatically?

    - by Marcus
    I am using IBM's Rational Application Developer. I have an ant script that contains the Java2WSDL task. When I run it via IBM, it gives compiler errors unless I include the j2ee.jar file in the classpath via the run tool (it does not pick up the jar files in the classpath in the script). However, I need to be able to call this script programmatically, and it is giving me this error: "java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException" I'm not sure which jars need to be added or where? Since a simple echo script runs, I assume that it is the j2ee.jar or another ant jar that needs to be added. I've added it to the project's buildpath, but that doesn't help. (I also have ant.jar, wsanttasks.jar, all the ant jars from the plugin, tools.jar, remoteAnt.jar, and the swt - all which are included in the buildpath when you run the script by itself.) Script: <?xml version="1.0" encoding="UTF-8"?> <project default="build" basedir="."> <path id="lib.path"> <fileset dir="C:\Program Files\IBM\WebSphere\AppServer\lib" includes="*.jar"/> <!-- Adding these does not help. <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins\org.apache.ant_1.6.5\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\jdk\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\configuration\org.eclipse.osgi\bundles\1139\1\.cp\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins" includes="*.jar"/> --> </path> <taskdef name="java2wsdl" classname="com.ibm.websphere.ant.tasks.Java2WSDL"> <classpath refid="lib.path"/> </taskdef> <target name="build"> <echo message="Beginning build"/> <javac srcdir="C:\J2W_Test\Java2Wsdl_Example" destdir="C:\J2W_Test\Java2Wsdl_Example"> <classpath refid="lib.path"/> <include name="WSExample.java"/> </javac> <echo message="Set up javac"/> <echo message="Running java2wsdl"/> <java2wsdl output="C:\J2W_Test\Java2Wsdl_Example\example\META-INF\wsdl\WSExample.wsdl" classpath="C:\J2W_Test\Java2Wsdl_Example" className= "example.WSExample" namespace="http://example" namespaceImpl="http://example" location="http://localhost:9080/example/services/WSExample" style="document" use="literal"> <mapping namespace="http://example" package="example"/> </java2wsdl> <echo message="Complete"/> </target> </project> Code: File buildFile = new File("build.xml"); Project p = new Project(); p.setUserProperty("ant.file", buildFile.getAbsolutePath()); DefaultLogger consoleLogger = new DefaultLogger(); consoleLogger.setErrorPrintStream(System.err); consoleLogger.setOutputPrintStream(System.out); consoleLogger.setMessageOutputLevel(Project.MSG_INFO); p.addBuildListener(consoleLogger); try { p.fireBuildStarted(); p.init(); ProjectHelper helper = ProjectHelper.getProjectHelper(); p.addReference("ant.projectHelper", helper); helper.parse(p, buildFile); p.executeTarget(p.getDefaultTarget()); p.fireBuildFinished(null); } catch (BuildException e) { p.fireBuildFinished(e); } Error: [java2wsdl] java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException [java2wsdl] at java.lang.J9VMInternals.verifyImpl(Native Method) [java2wsdl] at java.lang.J9VMInternals.verify(J9VMInternals.java:68) [java2wsdl] at java.lang.J9VMInternals.initialize(J9VMInternals.java:129) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getDiscoveredServiceProviders(ServiceProviderManager.java:378) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getAllServiceProviders(ServiceProviderManager.java:214) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.initPluggableBindings(Emitter.java:2704) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.<init>(Emitter.java:389) [java2wsdl] at com.ibm.ws.webservices.tools.ant.Java2WSDL.execute(Java2WSDL.java:122) [java2wsdl] at org.apache.tools.ant.UnknownElement.execute(UnknownElement.java:275) [java2wsdl] at org.apache.tools.ant.Task.perform(Task.java:364) [java2wsdl] at org.apache.tools.ant.Target.execute(Target.java:341) [java2wsdl] at org.apache.tools.ant.Target.performTasks(Target.java:369) [java2wsdl] at org.apache.tools.ant.Project.executeSortedTargets(Project.java:1216) [java2wsdl] at org.apache.tools.ant.Project.executeTarget(Project.java:1185) [java2wsdl] at att.ant.RunAnt.main(RunAnt.java:32)

    Read the article

  • jQuery Form Processing With PHP to MYSQL Database Using $.ajax Request

    - by FrustratedUser
    Question: How can I process a form using jQuery and the $.ajax request so that the data is passed to a script which writes it to a database? Problem: I have a simple email signup form that when processed, adds the email along with the current date to a table in a MySQL database. Processing the form without jQuery works as intended, adding the email and date. With jQuery, the form submits successfully and returns the success message. However, no data is added to the database. Any insight would be greatly appreciated! <!-- PROCESS.PHP --> <?php // DB info $dbhost = '#'; $dbuser = '#'; $dbpass = '#'; $dbname = '#'; // Open connection to db $conn = mysql_connect($dbhost, $dbuser, $dbpass) or die ('Error connecting to mysql'); mysql_select_db($dbname); // Form variables $email = $_POST['email']; $submitted = $_POST['submitted']; // Clean up function cleanData($str) { $str = trim($str); $str = strip_tags($str); $str = strtolower($str); return $str; } $email = cleanData($email); $error = ""; if(isset($submitted)) { if($email == '') { $error .= '<p class="error">Please enter your email address.</p>' . "\n"; } else if (!eregi("^[A-Z0-9._%-]+@[A-Z0-9._%-]+\.[A-Z]{2,4}$", $email)) { $error .= '<p class="error">Please enter a valid email address.</p>' . "\n"; } if(!$error){ echo '<p id="signup-success-nojs">You have successfully subscribed!</p>'; // Add to database $add_email = "INSERT INTO subscribers (email,date) VALUES ('$email',CURDATE())"; mysql_query($add_email) or die(mysql_error()); }else{ echo $error; } } ?> <!-- SAMPLE.PHP --> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Sample</title> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.2.6/jquery.min.js"></script> <script type="text/javascript"> $(document).ready(function(){ // Email Signup $("form#newsletter").submit(function() { var dataStr = $("#newsletter").serialize(); alert(dataStr); $.ajax({ type: "POST", url: "process.php", data: dataStr, success: function(del){ $('form#newsletter').hide(); $('#signup-success').fadeIn(); } }); return false; }); }); </script> <style type="text/css"> #email { margin-right:2px; padding:5px; width:145px; border-top:1px solid #ccc; border-left:1px solid #ccc; border-right:1px solid #eee; border-bottom:1px solid #eee; font-size:14px; color:#9e9e9e; } #signup-success { margin-bottom:20px; padding-bottom:10px; background:url(../img/css/divider-dots.gif) repeat-x 0 100%; display:none; } #signup-success p, #signup-success-nojs { padding:5px; background:#fff; border:1px solid #dedede; text-align:center; font-weight:bold; color:#3d7da5; } </style> </head> <body> <?php include('process.php'); ?> <form id="newsletter" class="divider" name="newsletter" method="post" action=""> <fieldset> <input id="email" type="text" name="email" /> <input id="submit-button" type="image" src="<?php echo $base_url; ?>/assets/img/css/signup.gif" alt=" SIGNUP " /> <input id="submitted" type="hidden" name="submitted" value="true" /> </fieldset> </form> <div id="signup-success"><p>You have successfully subscribed!</p></div> </body> </html>

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Fancy box and youtube video problems

    - by shinjuo
    I have some fancy box photos and a youtube video, but when the fancy box picture opens the youtube video sits in front of it? Any ideas? Here is a snippet of my code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <script type="text/javascript"> <!-- var newwindow; function newWindow(url) { newwindow=window.open(url,'name','height=600,width=625'); if (window.focus) {newwindow.focus()} } // --> </script> <meta content="text/html; charset=utf-8" http-equiv="Content-Type" /> <title>onco Construction and Supply - Rhino Shield</title> <script type="text/javascript" src="http://code.jquery.com/jquery-1.4.2.min.js"></script> <script type="text/javascript" src="fancybox/jquery.mousewheel-3.0.2.pack.js"></script> <script type="text/javascript" src="fancybox/jquery.fancybox-1.3.1.js"></script> <link rel="stylesheet" type="text/css" href="fancybox/jquery.fancybox-1.3.1.css" media="screen" /> <link rel="stylesheet" type="text/css" href="../style3.css" media="screen" /> <script type="text/javascript"> $(document).ready(function() { $("a[rel=example_group]").fancybox({ 'transitionIn' : 'elastic', 'transitionOut' : 'elastic', 'titlePosition' : 'over', 'titleFormat' : function(title, currentArray, currentIndex, currentOpts) { return '<span id="fancybox-title-over">Image ' + (currentIndex + 1) + ' / ' + currentArray.length + (title.length ? ' &nbsp; ' + title : '') + '</span>'; } }); }); </script> <style type="text/css"> .commercial { position: absolute; left:205px; top:1175px; width:327px; height:auto; } .pictures { position: absolute; left: 50px; top: 1090px; width: 750px; height: auto; text-align: center; } </style> </head> <body> <div class="pictures"> <a rel="example_group" href="images/rhino/1.jpg"> <img src="images/rhino/small/1.jpg" alt=""/></a> <a rel="example_group" href="images/rhino/2.jpg"> <img src="images/rhino/small/2.jpg" alt=""/></a> <a rel="example_group" href="images/rhino/3.jpg"> <img src="images/rhino/small/3.jpg" alt=""/></a> <a rel="example_group" href="images/rhino/4.jpg"> <img src="images/rhino/small/4.jpg" alt=""/></a> <a rel="example_group" href="images/rhino/5.jpg"> <img src="images/rhino/small/5.jpg" alt=""/></a> <a rel="example_group" href="images/rhino/6.jpg"> <img src="images/rhino/small/6.jpg" alt=""/></a> </div> <div class="commercial"> <object width="445" height="364"><param name="movie" value="http://www.youtube.com/v/Mw3gLivJkg0&hl=en_US&fs=1&rel=0&color1=0x2b405b&color2=0x6b8ab6&border=1"></param> <param name="allowFullScreen" value="true"></param> <param name="allowscriptaccess" value="always"></param> <embed src="http://www.youtube.com/v/Mw3gLivJkg0&hl=en_US&fs=1&rel=0&color1=0x2b405b&color2=0x6b8ab6&border=1" type="application/x-shockwave-flash" allowscriptaccess="always" allowfullscreen="true" width="445" height="364"> </embed> </object> </div> </body> </html>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • JSF 2 -- Composite component with optional listener attribute on f:ajax

    - by Dave Maple
    I have a composite component that looks something like this: <!DOCTYPE html> <html xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:dm="http://davemaple.com/dm-taglib" xmlns:rich="http://richfaces.org/rich" xmlns:cc="http://java.sun.com/jsf/composite" xmlns:fn="http://java.sun.com/jsp/jstl/functions" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:a4j="http://richfaces.org/a4j"> <cc:interface> <cc:attribute name="styleClass" /> <cc:attribute name="textBoxStyleClass" /> <cc:attribute name="inputTextId" /> <cc:attribute name="labelText" /> <cc:attribute name="tabindex" /> <cc:attribute name="required" default="false" /> <cc:attribute name="requiredMessage" /> <cc:attribute name="validatorId" /> <cc:attribute name="converterId" /> <cc:attribute name="title"/> <cc:attribute name="style"/> <cc:attribute name="unicodeSupport" default="false"/> <cc:attribute name="tooltip" default="false"/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="tooltipText" default=""/> <cc:attribute name="onfail" default=""/> <cc:attribute name="onpass" default=""/> </cc:interface> <cc:implementation> <ui:param name="converterId" value="#{! empty cc.attrs.converterId ? cc.attrs.converterId : 'universalConverter'}" /> <ui:param name="validatorId" value="#{! empty cc.attrs.validatorId ? cc.attrs.validatorId : 'universalValidator'}" /> <ui:param name="component" value="#{formFieldBean.getComponent(cc.attrs.inputTextId)}" /> <ui:param name="componentValid" value="#{((facesContext.maximumSeverity == null and empty component.valid) or component.valid) ? true : false}" /> <ui:param name="requiredMessage" value="#{! empty cc.attrs.requiredMessage ? cc.attrs.requiredMessage : msg['validation.generic.requiredMessage']}" /> <ui:param name="clientIdEscaped" value="#{fn:replace(cc.clientId, ':', '\\\\\\\\:')}" /> <h:panelGroup layout="block" id="#{cc.attrs.inputTextId}ValidPanel" style="display:none;"> <input type="hidden" id="#{cc.attrs.inputTextId}Valid" value="#{componentValid}" /> </h:panelGroup> <dm:outputLabel for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Label">#{cc.attrs.labelText}</dm:outputLabel> <dm:inputText styleClass="#{cc.attrs.textBoxStyleClass}" tabindex="#{cc.attrs.tabindex}" id="#{cc.attrs.inputTextId}" required="#{cc.attrs.required}" requiredMessage="#{requiredMessage}" title="#{cc.attrs.title}" unicodeSupport="#{cc.attrs.unicodeSupport}"> <f:validator validatorId="#{validatorId}" /> <f:converter converterId="#{converterId}" /> <cc:insertChildren /> <f:ajax event="blur" execute="@this" render="#{cc.attrs.inputTextId}ValidPanel #{cc.attrs.inputTextId}Msg" onevent="on#{cc.attrs.inputTextId}Event" /> </dm:inputText> <rich:message for="#{cc.clientId}:#{cc.attrs.inputTextId}" id="#{cc.attrs.inputTextId}Msg" style="display: none;" /> <script> function on#{cc.attrs.inputTextId}Event(e) { if(e.status == 'success') { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger($('##{cc.attrs.inputTextId}Valid').val()=='true'?'pass':'fail'); } } $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').bind('fail', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').addClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onfail} }).bind('pass', function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}, ##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Label, ##{cc.attrs.inputTextId}Msg, ##{cc.id}Msg').removeClass('error'); $('##{cc.id}Msg').html($('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}Msg').html()); #{cc.attrs.onpass} }); </script> <a4j:region rendered="#{facesContext.maximumSeverity != null and !componentValid}"> <script> $(document).ready(function() { $('##{clientIdEscaped}\\:#{cc.attrs.inputTextId}').trigger('fail'); }); </script> </a4j:region> </cc:implementation> </html> I'd like to be able to add an optional "listener" attribute which if defined would add an event listener to my f:ajax but I'm having trouble figuring out how to accomplish this. Any help would be appreciated.

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • migrating from Prototype to jQuery in Rails, having trouble with duplicate get request

    - by aressidi
    I'm in the process of migrating from Prototype to jQuery and moving all JS outside of the view files. All is going fairly well with one exception. Here's what I'm trying to do, and the problem I'm having. I have a diary where users can update records in-line in the page like so: user clicks 'edit' link to edit an entry in the diary a get request is performed via jQuery and an edit form is displayed allowing the user to modify the record user updates the record, the form disappears and the updated record is shown in place of the form All of that works so far. The problem arises when: user updates a record user clicks 'edit' to update another record in this case, the edit form is shown twice! In firebug I get a status code 200 when the form shows, and then moments later, another edit form shows again with a status code of 304 I only want the form to show once, not twice. The form shows twice only after I update a record, otherwise everything works fine. Here's the code, any ideas? I think this might have to do with the fact that in food_item_update.js I call the editDiaryEntry() after a record is updated, but if I don't call that function and try and update the record after it's been modified, then it just spits up the .js.erb response on the screen. That's also why I have the editDiaryEntry() in the add_food.js.erb file. Any help would be greatly appreciated. diary.js jQuery(document).ready(function() { postFoodEntry(); editDiaryEntry(); initDatePicker(); }); function postFoodEntry() { jQuery('form#add_entry').submit(function(e) { e.preventDefault(); jQuery.post(this.action, jQuery(this).serialize(), null, "script"); // return this }); } function editDiaryEntry() { jQuery('.edit_link').click(function(e) { e.preventDefault(); // This should look to see if one version of this is open... if (jQuery('#edit_container_' + this.id).length == 0 ) { jQuery.get('/diary/entry/edit', {id: this.id}, null, "script"); } }); } function closeEdit () { jQuery('.close_edit').click(function(e) { e.preventDefault(); jQuery('.entry_edit_container').remove(); jQuery("#entry_" + this.id).show(); }); } function updateDiaryEntry() { jQuery('.edit_entry_form').submit(function(e) { e.preventDefault(); jQuery.post(this.action, $(this).serialize(), null, "script"); }); } function initDatePicker() { jQuery("#date, #edit_date").datepicker(); }; add_food.js.erb jQuery("#entry_alert").show(); jQuery('#add_entry')[ 0 ].reset(); jQuery('#diary_entries').html("<%= escape_javascript(render :partial => 'members/diary/diary_entries', :object => @diary, :locals => {:record_counter => 0, :date_header => 0, :edit_mode => @diary_edit}, :layout => false ) %>"); jQuery('#entry_alert').html("<%= escape_javascript(render :partial => 'members/diary/entry_alert', :locals => {:type => @type, :message => @alert_message}) %>"); jQuery('#entry_alert').show(); setTimeout(function() { jQuery('#entry_alert').fadeOut('slow'); }, 5000); editDiaryEntry(); food_item_edit.js.erb jQuery("#entry_<%= @entry.id %>").hide(); jQuery("#entry_<%= @entry.id %>").after("<%= escape_javascript(render :partial => 'members/diary/food_item_edit', :locals => {:user_food_profile => @entry}) %>"); closeEdit(); updateDiaryEntry(); initDatePicker(); food_item_update.js jQuery("#entry_<%= @entry.id %>").replaceWith("<%= escape_javascript(render :partial => 'members/diary/food_item', :locals => {:entry => @entry, :total_calories => 0}) %>"); jQuery('.entry_edit_container').remove(); editDiaryEntry();

    Read the article

  • NHibernate AssertException: Interceptor.OnPrepareStatement(SqlString) returned null or empty SqlString.

    - by jwynveen
    I am trying to switch a table from being a many-to-one mapping to being many-to-many with an intermediate mapping table. However, when I switched it over and tried to do a query on it with NHibernate, it's giving me this error: "Interceptor.OnPrepareStatement(SqlString) returned null or empty SqlString." My query was originally something more complex, but I switched it to a basic fetch all and I'm still having the problem: Session.QueryOver<T>().Future(); It would seem to either be a problem in my model mapping files or something in my database. Here are my model mappings: <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="Market" table="gbi_Market"> <id name="Id" column="MarketId"> <generator class="identity" /> </id> <property name="Name" /> <property name="Url" /> <property name="Description" type="StringClob" /> <property name="Rating" /> <property name="RatingComment" /> <property name="RatingCommentedOn" /> <many-to-one name="RatingCommentedBy" column="RatingCommentedBy" lazy="proxy"></many-to-one> <property name="ImageFilename" /> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> <set name="Content" where="IsDeleted=0 and ParentContentId is NULL" order-by="Ordering asc, CreatedOn asc, Name asc" lazy="extra"> <key column="MarketId" /> <one-to-many class="MarketContent" /> </set> <set name="FastFacts" where="IsDeleted=0" order-by="Ordering asc, CreatedOn asc, Name asc" lazy="extra"> <key column="MarketId" /> <one-to-many class="MarketFastFact" /> </set> <set name="NewsItems" table="gbi_NewsItem_Market_Map" lazy="true"> <key column="MarketId" /> <many-to-many class="NewsItem" fetch="join" column="NewsItemId" where="IsDeleted=0"/> </set> <!--<set name="MarketUpdates" table="gbi_Market_MarketUpdate_Map" lazy="extra"> <key column="MarketId" /> <many-to-many class="MarketUpdate" fetch="join" column="MarketUpdateId" where="IsDeleted=0" order-by="CreatedOn desc" /> </set>--> <set name="Documents" table="gbi_Market_Document_Map" lazy="true"> <key column="MarketId" /> <many-to-many class="Document" fetch="join" column="DocumentId" where="IsDeleted=0"/> </set> </class> <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="MarketUpdate" table="gbi_MarketUpdate"> <id name="Id" column="MarketUpdateId"> <generator class="identity" /> </id> <property name="Description" /> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <!--<many-to-one name="Market" column="MarketId" lazy="proxy"></many-to-one>--> <set name="Comments" where="IsDeleted=0" order-by="CreatedOn desc" lazy="extra"> <key column="MarketUpdateId" /> <one-to-many class="MarketUpdateComment" /> </set> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> </class> <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="GBI.Core" namespace="GBI.Core.Models"> <class name="MarketUpdateMarketMap" table="gbi_Market_MarketUpdate_Map"> <id name="Id" column="MarketUpdateMarketMapId"> <generator class="identity" /> </id> <property name="CreatedOn" /> <property name="ModifiedOn" /> <property name="IsDeleted" /> <many-to-one name="CreatedBy" column="CreatedBy" lazy="proxy"></many-to-one> <many-to-one name="ModifiedBy" column="ModifiedBy" lazy="proxy"></many-to-one> <many-to-one name="MarketUpdate" column="MarketUpdateId" lazy="proxy"></many-to-one> <many-to-one name="Market" column="MarketId" lazy="proxy"></many-to-one> </class> As I mentioned, MarketUpdate was originally a many-to-one with Market (MarketId column is still in there, but I'm ignoring it. Could this be a problem?). But I've added in the Market_MarketUpdate_Map table to make it a many-to-many. I'm running in circles trying to figure out what this could be. I couldn't find any reference to this error when searching. And it doesn't provide much detail. Using: NHibernate 2.2 .NET 4.0 SQL Server 2005

    Read the article

  • Customer Attribute, not sorting select options

    - by Bosworth99
    Made a module that creates some customer EAV attributes. One of these attributes is a Select, and I'm dropping a bunch of options into their respective tables. Everything lines up and is accessible on both the front end and the back. Last thing before calling this part of things finished is the sort order of the options. They come out all scrambled, instead of the obvious default or alphabetical (seemingly at random... very wierd). I'm on Mage v1.11 (Pro/Enterprise). config.xml <config> <modules> <WACI_CustomerAttr> <version>0.1.0</version> </WACI_CustomerAttr> </modules> <global> <resources> <customerattr_setup> <setup> <module>WACI_CustomerAttr</module> <class>Mage_Customer_Model_Entity_Setup</class> </setup> <connection> <use>core_setup</use> </connection> </customerattr_setup> </resources> <models> <WACI_CustomerAttr> <class>WACI_CustomerAttr_Model</class> </WACI_CustomerAttr> </models> <fieldsets> <customer_account> <agency><create>1</create><update>1</update></agency> <title><create>1</create><update>1</update></title> <phone><create>1</create><update>1</update></phone> <mailing_address><create>1</create><update>1</update></mailing_address> <city><create>1</create><update>1</update></city> <state><create>1</create><update>1</update></state> <zip><create>1</create><update>1</update></zip> <fed_id><create>1</create><update>1</update></fed_id> <ubi><create>1</create><update>1</update></ubi> </customer_account> </fieldsets> </global> </config> mysql4-install-0.1.0.php <?php Mage::log('Installing WACI_CustomerAttr'); echo 'Running Upgrade: '.get_class($this)."\n <br /> \n"; //die ( 'its running' ); $installer = $this; /* @var $installer Mage_Customer_Model_Entity_Setup */ $installer->startSetup(); // bunch of attributes // State $installer->addAttribute('customer','state', array( 'type' => 'varchar', 'group' => 'Default', 'label' => 'State', 'input' => 'select', 'default' => 'Washington', 'source' => 'WACI_CustomerAttr/customer_attribute_data_select', 'global' => Mage_Catalog_Model_Resource_Eav_Attribute::SCOPE_STORE, 'required' => true, 'visible' => true, 'user_defined' => 1, 'position' => 67 ) ); $attrS = Mage::getSingleton('eav/config')->getAttribute('customer', 'state'); $attrS->addData(array('sort_order'=>67)); $attrS->setData('used_in_forms', array('adminhtml_customer','customer_account_edit','customer_account_create'))->save(); $state_list = array('Alabama','Alaska','Arizona','Arkansas','California','Colorado','Connecticut','Delaware','Florida','Georgia', 'Hawaii','Idaho','Illinois','Indiana','Iowa','Kansas','Kentucky','Louisiana','Maine','Maryland','Massachusetts','Michigan', 'Minnesota','Mississippi','Missouri','Montana','Nebraska','Nevada','New Hampshire','New Jersey','New Mexico','New York', 'North Carolina','North Dakota','Ohio','Oklahoma','Oregon','Pennsylvania','Rhode Island','South Carolina','South Dakota', 'Tennessee','Texas','Utah','Vermont','Virginia','Washington','West Virginia','Wisconsin','Wyoming'); $aOption = array(); $aOption['attribute_id'] = $installer->getAttributeId('customer', 'state'); for($iCount=0;$iCount<sizeof($state_list);$iCount++){ $aOption['value']['option'.$iCount][0] = $state_list[$iCount]; } $installer->addAttributeOption($aOption); // a few more $installer->endSetup(); app/code/local/WACI/CustomerAttr/Model/Customer/Attribute/Data/Select.php <?php class WACI_CustomerAttr_Model_Customer_Attribute_Data_Select extends Mage_Eav_Model_Entity_Attribute_Source_Abstract{ function getAllOptions(){ if (is_null($this->_options)) { $this->_options = Mage::getResourceModel('eav/entity_attribute_option_collection') ->setAttributeFilter($this->getAttribute()->getId()) ->setStoreFilter($this->getAttribute()->getStoreId()) ->setPositionOrder('asc') ->load() ->toOptionArray(); } $options = $this->_options; return $options; } } theme/variation/template/persistent/customer/form/register.phtml <li> <?php $attribute = Mage::getModel('eav/config')->getAttribute('customer','state'); ?> <label for="state" class="<?php if($attribute->getIsRequired() == true){?>required<?php } ?>"><?php if($attribute->getIsRequired() == true){?><em>*</em><?php } ?><?php echo $this->__('State') ?></label> <div class="input-box"> <select name="state" id="state" class="<?php if($attribute->getIsRequired() == true){?>required-entry<?php } ?>"> <?php $options = $attribute->getSource()->getAllOptions(); foreach($options as $option){ ?> <option value='<?php echo $option['value']?>' <?php if($this->getFormData()->getState() == $option['value']){ echo 'selected="selected"';}?>><?php echo $this->__($option['label'])?></option> <?php } ?> </select> </div> </li> All options are getting loaded into table eav_attribute_option just fine (albeit without a sort_order defined), as well as table eav_attribute_option_value. In the adminhtml / customer-manage customers-account information this select is showing up fine (but its delivered automatically by the system). Seems I should be able to set the sort-order on creation of the attributeOptions, or, certainly, define the sort order in the data/select class. But nothing I've tried works. I'd rather not do a front-end hack either... Oh, and how do I set the default value of this select? (Different question, I know, but related). Setting the attributes 'default' = 'washington' seems to do nothing. There seem to be a lot of ways to set up attribute select options like this. Is there a better way that the one I've outlined here? Perhaps I'm messing something up. Cheers

    Read the article

  • Twitter Bootstrap Collapsible Navbar Duplicating

    - by sixeightzero
    I am working on a project using Twitter Bootstrap. One thing that I noticed is that my pages have duplicate navbars when they are defined as collapsible and the page is resized smaller. Here is the duplicate NavBar: Here is the normal width NavBar: Code: <!DOCTYPE html> <html lang="en"> <!--[if lt IE 7]> <html class="no-js lt-ie9 lt-ie8 lt-ie7"> <![endif]--> <!--[if IE 7]> <html class="no-js lt-ie9 lt-ie8"> <![endif]--> <!--[if IE 8]> <html class="no-js lt-ie9"> <![endif]--> <!--[if gt IE 8]><!--> <html class="no-js"> <!--<![endif]--> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <title></title> <meta name="description" content=""> <meta name="viewport" content="width=device-width"> <link rel="stylesheet" href="/assets/css/bootstrap.css"> <style> body { padding-top: 60px; } </style> <link rel="stylesheet" href="/assets/css/bootstrap-responsive.min.css"> <link rel="stylesheet" href="/assets/css/main.css"> <script>window.jQuery || document.write('<script src="/assets/js/vendor/jquery-1.8.1.min.js"><\/script>')</script> <script src="/assets/js/vendor/modernizr-2.6.1-respond-1.1.0.min.js"></script> </head> <body class="dark"> <!--[if lt IE 9]> <p class="chromeframe">You are using an outdated browser. <a href="http://browsehappy.com/">Upgrade your browser today</a> or <a href="http://www.google.com/chromeframe/?redirect=true">install Google Chrome Frame</a> to better experience this site.</p> <![endif]--> <div class="navbar navbar-inverse navbar-fixed-top"> <div class="navbar-inner"> <div class="container"> <a class="btn btn-navbar" data-toggle="collapse" data-target=".nav-collapse"> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </a> <a class="brand" href="#">Project name</a> <div class="nav-collapse collapse"> <ul class="nav"> <li class="active"><a href="#">Home</a></li> <li><a href="#about">About</a></li> <li><a href="#contact">Contact</a></li> <li class="dropdown"> <a href="#" class="dropdown-toggle" data-toggle="dropdown">Dropdown <b class="caret"></b></a> <ul class="dropdown-menu"> <li><a href="#">Action</a></li> <li><a href="#">Another action</a></li> <li><a href="#">Something else here</a></li> <li class="divider"></li> <li class="nav-header">Nav header</li> <li><a href="#">Separated link</a></li> <li><a href="#">One more separated link</a></li> </ul> </li> </ul> </div><!--/.nav-collapse --> </div> </div> </div> Has anyone else run into this and have some pointers?

    Read the article

  • Creating PHP Forms with show/hide functionality [migrated]

    - by ronquiq
    I want to create two reports and submit the report data to database by using two functions defined in a class: Here I have two buttons: "Create ES" and "Create RP". Rightnow, my forms are working fine, I can insert data successfully, but the problem was when I click on submit after filling the form data, the content is hiding and displays the fist div content "cs_content" and again I need to onclick to submit again. Could anyone give a solution for this. Requirement : When I click on "Create CS", I should be able to fill the form and submit data successfully with a message within "cs_content" and any form input errors, the errors should display within "cs_content". When I click on "Create RP", I should be able to fill the form and submit data successfully with a message within "rp_content" and any form input errors, the errors should display within "rp_content". home.php <?php require 'classes/class.report.php'; $report = new Report($db); ?> <html> <head> <script src="js/jqueryv1.10.2.js"></script> <script> $ (document).ready(function () { //$("#cs_content").show(); $('#cs').click(function () { $('#cs_content').fadeIn('slow'); $('#rp_content').hide(); }); $('#rp').click(function () { $('#rp_content').fadeIn('slow'); $('#cs_content').hide(); }); }); </script> </head> <body> <div class="container2"> <div style="margin:0px 0px;padding:3px 217px;overflow:hidden;"> <div id="cs" style="float:left;margin:0px 0px;padding:7px;"><input type="button" value="CREATE CS"></div> <div id="rp" style="float:left;margin:0px 0px;padding:7px;"><input type="button" value="CREATE RP"></div><br> </div> <div id="cs_content"> <?php $report->create_cs_report(); ?> </div> <div id="rp_content" style="display:none;"> <?php $report->create_rp_report(); ?> </div> </div> </body> </html> class.report.php <?php class Report { private $db; public function __construct($database){ $this->db = $database; } public function create_cs_report() { if (isset($_POST['create_es_report'])) { $report_name = htmlentities($_POST['report_name']); $from_address = htmlentities($_POST['from_address']); $subject = htmlentities($_POST['subject']); $reply_to = htmlentities($_POST['reply_to']); if (empty($_POST['report_name']) || empty($_POST['from_address']) || empty($_POST['subject']) || empty($_POST['reply_to'])) { $errors[] = '<span class="error">All fields are required.</span>'; } else { if (isset($_POST['report_name']) && empty($_POST['report_name'])) { $errors[] = '<span class="error">Report Name is required</span>'; } else if (!ctype_alnum($_POST['report_name'])) { $errors[] = '<span class="error">Report Name: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['from_address']) && empty($_POST['from_address'])) { $errors[] = '<span class="error">From address is required</span>'; } else if (filter_var($_POST['from_address'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid From address</span>'; } if (isset($_POST['subject']) && empty($_POST['subject'])) { $errors[] = '<span class="error">Subject is required</span>'; } else if (!ctype_alnum($_POST['subject'])) { $errors[] = '<span class="error">Subject: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['reply_to']) && empty($_POST['reply_to'])) { $errors[] = '<span class="error">Reply To is required</span>'; } else if (filter_var($_POST['reply_to'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid Reply-To address</span>'; } } if (empty($errors) === true) { $query = $this->db->prepare("INSERT INTO report(report_name, from_address, subject, reply_to) VALUES (?, ?, ?, ?) "); $query->bindValue(1, $report_name); $query->bindValue(2, $from_address); $query->bindValue(3, $subject); $query->bindValue(4, $reply_to); try { $query->execute(); } catch(PDOException $e) { die($e->getMessage()); } header('Location:home.php?success'); exit(); } } if (isset($_GET['success']) && empty($_GET['success'])) { header('Location:home.php'); echo '<span class="error">Report is succesfully created</span>'; } ?> <form action="" method="POST" accept-charset="UTF-8"> <div style="font-weight:bold;padding:17px 80px;text-decoration:underline;">Section A</div> <table class="create_report"> <tr><td><label>Report Name</label><span style="color:#A60000">*</span></td> <td><input type="text" name="report_name" required placeholder="Name of the report" value="<?php if(isset($_POST["report_name"])) echo $report_name; ?>" size="30" maxlength="30"> </td></tr> <tr><td><label>From</label><span style="color:#A60000">*</span></td> <td><input type="text" name="from_address" required placeholder="From address" value="<?php if(isset($_POST["from_address"])) echo $from_address; ?>" size="30"> </td></tr> <tr><td><label>Subject</label><span style="color:#A60000">*</span></td> <td><input type="text" name="subject" required placeholder="Subject" value="<?php if(isset($_POST["subject"])) echo $subject; ?>" size="30"> </td></tr> <tr><td><label>Reply To</label><span style="color:#A60000">*</span></td> <td><input type="text" name="reply_to" required placeholder="Reply address" value="<?php if(isset($_POST["reply_to"])) echo $reply_to; ?>" size="30"> </td></tr> <tr><td><input type="submit" value="create report" style="background:#8AC007;color:#080808;padding:6px;" name="create_es_report"></td></tr> </table> </form> <?php //IF THERE ARE ERRORS, THEY WOULD BE DISPLAY HERE if (empty($errors) === false) { echo '<div>' . implode('</p><p>', $errors) . '</div>'; } } public function create_rp_report() { if (isset($_POST['create_rp_report'])) { $report_name = htmlentities($_POST['report_name']); $to_address = htmlentities($_POST['to_address']); $subject = htmlentities($_POST['subject']); $reply_to = htmlentities($_POST['reply_to']); if (empty($_POST['report_name']) || empty($_POST['to_address']) || empty($_POST['subject']) || empty($_POST['reply_to'])) { $errors[] = '<span class="error">All fields are required.</span>'; } else { if (isset($_POST['report_name']) && empty($_POST['report_name'])) { $errors[] = '<span class="error">Report Name is required</span>'; } else if (!ctype_alnum($_POST['report_name'])) { $errors[] = '<span class="error">Report Name: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['to_address']) && empty($_POST['to_address'])) { $errors[] = '<span class="error">to address is required</span>'; } else if (filter_var($_POST['to_address'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid to address</span>'; } if (isset($_POST['subject']) && empty($_POST['subject'])) { $errors[] = '<span class="error">Subject is required</span>'; } else if (!ctype_alnum($_POST['subject'])) { $errors[] = '<span class="error">Subject: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['reply_to']) && empty($_POST['reply_to'])) { $errors[] = '<span class="error">Reply To is required</span>'; } else if (filter_var($_POST['reply_to'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid Reply-To address</span>'; } } if (empty($errors) === true) { $query = $this->db->prepare("INSERT INTO report(report_name, to_address, subject, reply_to) VALUES (?, ?, ?, ?) "); $query->bindValue(1, $report_name); $query->bindValue(2, $to_address); $query->bindValue(3, $subject); $query->bindValue(4, $reply_to); try { $query->execute(); } catch(PDOException $e) { die($e->getMessage()); } header('Location:home.php?success'); exit(); } } if (isset($_GET['success']) && empty($_GET['success'])) { header('Location:home.php'); echo '<span class="error">Report is succesfully created</span>'; } ?> <form action="" method="POST" accept-charset="UTF-8"> <div style="font-weight:bold;padding:17px 80px;text-decoration:underline;">Section A</div> <table class="create_report"> <tr><td><label>Report Name</label><span style="color:#A60000">*</span></td> <td><input type="text" name="report_name" required placeholder="Name of the report" value="<?php if(isset($_POST["report_name"])) echo $report_name; ?>" size="30" maxlength="30"> </td></tr> <tr><td><label>to</label><span style="color:#A60000">*</span></td> <td><input type="text" name="to_address" required placeholder="to address" value="<?php if(isset($_POST["to_address"])) echo $to_address; ?>" size="30"> </td></tr> <tr><td><label>Subject</label><span style="color:#A60000">*</span></td> <td><input type="text" name="subject" required placeholder="Subject" value="<?php if(isset($_POST["subject"])) echo $subject; ?>" size="30"> </td></tr> <tr><td><label>Reply To</label><span style="color:#A60000">*</span></td> <td><input type="text" name="reply_to" required placeholder="Reply address" value="<?php if(isset($_POST["reply_to"])) echo $reply_to; ?>" size="30"> </td></tr> <tr><td><input type="submit" value="create report" style="background:#8AC007;color:#080808;padding:6px;" name="create_rp_report"></td></tr> </table> </form> <?php //IF THERE ARE ERRORS, THEY WOULD BE DISPLAY HERE if (empty($errors) === false) { echo '<div>' . implode('</p><p>', $errors) . '</div>'; } } }//Report CLASS ENDS

    Read the article

  • plupload variable upload path?

    - by SoulieBaby
    Hi all, I'm using plupload to upload files to my server (http://www.plupload.com/index.php), however I wanted to know if there was any way of making the upload path variable. Basically I need to select the upload path folder first, then choose the files using plupload and then upload to the initially selected folder. I've tried a few different ways but I can't seem to pass along the variable folder path to the upload.php file. I'm using the flash version of plupload. If someone could help me out, that would be fantastic!! :) Here's my plupload jquery: jQuery.noConflict(); jQuery(document).ready(function() { jQuery("#flash_uploader").pluploadQueue({ // General settings runtimes: 'flash', url: '/assets/upload/upload.php', max_file_size: '10mb', chunk_size: '1mb', unique_names: false, // Resize images on clientside if we can resize: {width: 500, height: 350, quality: 100}, // Flash settings flash_swf_url: '/assets/upload/flash/plupload.flash.swf' }); }); And here's the upload.php file: <?php /** * upload.php * * Copyright 2009, Moxiecode Systems AB * Released under GPL License. * * License: http://www.plupload.com/license * Contributing: http://www.plupload.com/contributing */ // HTTP headers for no cache etc header('Content-type: text/plain; charset=UTF-8'); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: ".gmdate("D, d M Y H:i:s")." GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); // Settings $targetDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads"; //temp directory <- need these to be variable $finalDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads2"; //final directory <- need these to be variable $cleanupTargetDir = true; // Remove old files $maxFileAge = 60 * 60; // Temp file age in seconds // 5 minutes execution time @set_time_limit(5 * 60); // usleep(5000); // Get parameters $chunk = isset($_REQUEST["chunk"]) ? $_REQUEST["chunk"] : 0; $chunks = isset($_REQUEST["chunks"]) ? $_REQUEST["chunks"] : 0; $fileName = isset($_REQUEST["name"]) ? $_REQUEST["name"] : ''; // Clean the fileName for security reasons $fileName = preg_replace('/[^\w\._]+/', '', $fileName); // Create target dir if (!file_exists($targetDir)) @mkdir($targetDir); // Remove old temp files if (is_dir($targetDir) && ($dir = opendir($targetDir))) { while (($file = readdir($dir)) !== false) { $filePath = $targetDir . DIRECTORY_SEPARATOR . $file; // Remove temp files if they are older than the max age if (preg_match('/\\.tmp$/', $file) && (filemtime($filePath) < time() - $maxFileAge)) @unlink($filePath); } closedir($dir); } else die('{"jsonrpc" : "2.0", "error" : {"code": 100, "message": "Failed to open temp directory."}, "id" : "id"}'); // Look for the content type header if (isset($_SERVER["HTTP_CONTENT_TYPE"])) $contentType = $_SERVER["HTTP_CONTENT_TYPE"]; if (isset($_SERVER["CONTENT_TYPE"])) $contentType = $_SERVER["CONTENT_TYPE"]; if (strpos($contentType, "multipart") !== false) { if (isset($_FILES['file']['tmp_name']) && is_uploaded_file($_FILES['file']['tmp_name'])) { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen($_FILES['file']['tmp_name'], "rb"); if ($in) { while ($buff = fread($in, 4096)) fwrite($out, $buff); } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); unlink($_FILES['file']['tmp_name']); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } else die('{"jsonrpc" : "2.0", "error" : {"code": 103, "message": "Failed to move uploaded file."}, "id" : "id"}'); } else { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen("php://input", "rb"); if ($in) { while ($buff = fread($in, 4096)){ fwrite($out, $buff); } } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } //Moves the file from $targetDir to $finalDir after receiving the final chunk if($chunk == ($chunks-1)){ rename($targetDir . DIRECTORY_SEPARATOR . $fileName, $finalDir . DIRECTORY_SEPARATOR . $fileName); } // Return JSON-RPC response die('{"jsonrpc" : "2.0", "result" : null, "id" : "id"}'); ?>

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • Watching setTimeout loops so that only one is running at a time.

    - by DA
    I'm creating a content rotator in jQuery. 5 items total. Item 1 fades in, pauses 10 seconds, fades out, then item 2 fades in. Repeat. Simple enough. Using setTimeout I can call a set of functions that create a loop and will repeat the process indefinitely. I now want to add the ability to interrupt this rotator at any time by clicking on a navigation element to jump directly to one of the content items. I originally started going down the path of pinging a variable constantly (say every half second) that would check to see if a navigation element was clicked and, if so, abandon the loop, then restart the loop based on the item that was clicked. The challenge I ran into was how to actually ping a variable via a timer. The solution is to dive into JavaScript closures...which are a little over my head but definitely something I need to delve into more. However, in the process of that, I came up with an alternative option that actually seems to be better performance-wise (theoretically, at least). I have a sample running here: http://jsbin.com/uxupi/14 (It's using console.log so have fireBug running) Sample script: $(document).ready(function(){ var loopCount = 0; $('p#hello').click(function(){ loopCount++; doThatThing(loopCount); }) function doThatOtherThing(currentLoopCount) { console.log('doThatOtherThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatThing(currentLoopCount)},5000) } } function doThatThing(currentLoopCount) { console.log('doThatThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatOtherThing(currentLoopCount)},5000); } } }) The logic being that every click of the trigger element will kick off the loop passing into itself a variable equal to the current value of the global variable. That variable gets passed back and forth between the functions in the loop. Each click of the trigger also increments the global variable so that subsequent calls of the loop have a unique local variable. Then, within the loop, before the next step of each loop is called, it checks to see if the variable it has still matches the global variable. If not, it knows that a new loop has already been activated so it just ends the existing loop. Thoughts on this? Valid solution? Better options? Caveats? Dangers? UPDATE: I'm using John's suggestion below via the clearTimeout option. However, I can't quite get it to work. The logic is as such: var slideNumber = 0; var timeout = null; function startLoop(slideNumber) { ...do stuff here to set up the slide based on slideNumber... slideFadeIn() } function continueCheck(){ if (timeout != null) { // cancel the scheduled task. clearTimeout(timeout); timeout = null; return false; }else{ return true; } }; function slideFadeIn() { if (continueCheck){ // a new loop hasn't been called yet so proceed... // fade in the LI $currentListItem.fadeIn(fade, function() { if(multipleFeatures){ timeout = setTimeout(slideFadeOut,display); } }); }; function slideFadeOut() { if (continueLoop){ // a new loop hasn't been called yet so proceed... slideNumber=slideNumber+1; if(slideNumber==features.length) { slideNumber = 0; }; timeout = setTimeout(function(){startLoop(slideNumber)},100); }; startLoop(slideNumber); The above kicks of the looping. I then have navigation items that, when clicked, I want the above loop to stop, then restart with a new beginning slide: $(myNav).click(function(){ clearTimeout(timeout); timeout = null; startLoop(thisItem); }) If I comment out 'startLoop...' from the click event, it, indeed, stops the initial loop. However, if I leave that last line in, it doesn't actually stop the initial loop. Why? What happens is that both loops seem to run in parallel for a period. So, when I click my navigation, clearTimeout is called, which clears it.

    Read the article

  • jQuery Cycle Plugin - Content not cycling

    - by fmz
    I am setting up a page with jQuery's Cycle plugin and have four divs set to fade. I have the code in place, the images set, but it doesn't cycle properly. Firefox says there is a problem with the following code: <script type="text/javascript"> $(document).ready(function() { $('.slideshow').cycle({ fx: 'fade' }); }); </script> Here is the html: <div class="slideshow"> <div id="mainImg-1" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number One.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-2" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Two.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-3" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number three.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-4" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Fout.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> Here is the CSS: .slideshow { width: 946px; height: 283px; border: 1px solid #c29c5d; margin: 8px; overflow: hidden; z-index: 1; } #mainImg-1 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-2 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-3 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-4 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-1 .quote, #mainImg-2 .quote, #mainImg-3 .quote, #mainImg-4 .quote { width: 608px; height: 168px; float: right; margin: 80px 11px 0 0; background: url(../_images/bg_quoteBox.png) repeat-x; } Before you go off and say, "hey, those images are all the same". You are right, the images are all the same right now, but the text should be rotating as well and there is a slight difference there. In addition, the fade should still show up. Anyway, you can see the dev page here: http://173.201.163.213/projectpath/first_trust/index.html I would appreciate some help to get this cycling through as it should. Thanks!

    Read the article

  • PHP, MySQL, jQuery, AJAX: json data returns correct response but frontend returns error

    - by Devner
    Hi all, I have a user registration form. I am doing server side validation on the fly via AJAX. The quick summary of my problem is that upon validating 2 fields, I get error for the second field validation. If I comment first field, then the 2nd field does not show any error. It has this weird behavior. More details below: The HTML, JS and Php code are below: HTML FORM: <form id="SignupForm" action=""> <fieldset> <legend>Free Signup</legend> <label for="username">Username</label> <input name="username" type="text" id="username" /><span id="status_username"></span><br /> <label for="email">Email</label> <input name="email" type="text" id="email" /><span id="status_email"></span><br /> <label for="confirm_email">Confirm Email</label> <input name="confirm_email" type="text" id="confirm_email" /><span id="status_confirm_email"></span><br /> </fieldset> <p> <input id="sbt" type="button" value="Submit form" /> </p> </form> JS: <script type="text/javascript"> $(document).ready(function() { $("#email").blur(function() { var email = $("#email").val(); var msgbox2 = $("#status_email"); if(email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: "email="+ email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } }); } return false; }); $("#confirm_email").blur(function() { var confirm_email = $("#confirm_email").val(); var email = $("#email").val(); var msgbox3 = $("#status_confirm_email"); if(confirm_email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: 'confirm_email='+ confirm_email + '&email=' + email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } , error: function (data) { alert('Some error'); } }); } return false; }); }); </script> PHP code: <?php //check_ajax2.php if(isset($_POST['email'])) { $email = $_POST['email']; $res = mysql_query("SELECT uid FROM members WHERE email = '$email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { $success = 'y'; $msg_email = 'Email available'; } else { $success = 'n'; $msg_email = 'Email is already in use.</font>'; } print json_encode(array('success' => $success, 'msg_email' => $msg_email)); } if(isset($_POST['confirm_email'])) { $confirm_email = $_POST['confirm_email']; $email = ( isset($_POST['email']) && trim($_POST['email']) != '' ? $_POST['email'] : '' ); $res = mysql_query("SELECT uid FROM members WHERE email = '$confirm_email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { if( isset($email) && isset($confirm_email) && $email == $confirm_email ) { $success = 'y'; $msg_confirm_email = 'Email available and match'; } else { $success = 'n'; $msg_confirm_email = 'Email and Confirm Email do NOT match.'; } } else { $success = 'n'; $msg_confirm_email = 'Email already exists.'; } print json_encode(array('success' => $success, 'msg_confirm_email' => $msg_confirm_email)); } ?> THE PROBLEM: As long as I am validating the $_POST['email'] as well as $_POST['confirm_email'] in the check_ajax2.php file, the validation for confirm_email field always returns an error. With my limited knowledge of Firebug, however, I did find out that the following were the responses when I entered email and confirm_email in the fields: RESPONSE 1: {"success":"y","msg_email":"Email available"} RESPONSE 2: {"success":"y","msg_email":"Email available"}{"success":"n","msg_confirm_email":"Email and Confirm Email do NOT match."} Although the RESPONSE 2 shows that we are receiving the correct message via msg_confirm_email, in the front end, the alert 'Some error' is popping up (I have enabled the alert for debugging). I have spent 48 hours trying to change every part of the code wherever possible, but with only little success. What is weird about this is that if I comment the validation for $_POST['email'] field completely, then the validation for $_POST['confirm_email'] field is displaying correctly without any errors. If I enable it back, it is validating email field correctly, but when it reaches the point of validating confirm_email field, it is again showing me the error. I have also tried renaming success variable in check_ajax2.php page to other different names for both $_POST['email'] and $_POST['confirm_email'] but no success. I will be adding more fields in the form and validating within the check_ajax2.php page. So I am not planning on using different ajax pages for validating each of those fields (and I don't think it's smart to do it that way). I am not a jquery or AJAX guru, so all help in resolving this issue is highly appreciated. Thank you in advance.

    Read the article

  • How to upgrade your Solaris 11 with the latest available SRUs ?

    - by jim
    1 ) Follow the instructions (*) in the document "Updating the Software on Your Oracle Solaris 11 System" * see and apply "How to Configure the Oracle Solaris support Repository" then run: # pkg update --accept Reboot if necessary (see "why" in STEP 3) Note: it is possible that your "pkg" package is not up to date # pkg update WARNING: pkg(5) appears to be out of date, and should be updated before running update.  Please update pkg(5) using 'pfexec pkg install pkg:/package/pkg' and then retry the update. -> So just upgrade it: # pkg install pkg:/package/pkg Reboot if necessary (see "why" in STEP 3) By the way, note that I am using the DEV tree: # pkg publisher -PPUBLISHER                             TYPE     STATUS   URIsolaris                               origin   online   https://pkg.oracle.com/solaris/dev/ 2 ) Now our system is ready to jump to the latest SRUs so check what is available: # pkg list -af entire NAME (PUBLISHER)                     VERSION                    IFO entire                                            0.5-DOT-11-0.175.1.0.0.24-DOT-2    ---   --> Latest version available in the repository ! entire                                            0.5.11-0.175.1.0.0.24.0    --- entire                                            0.5.11-0.175.1.0.0.23.0    --- entire                                            0.5.11-0.175.1.0.0.22.1    --- entire                                            0.5.11-0.175.1.0.0.21.0    --- entire                                            0.5.11-0.175.1.0.0.20.0    --- entire                                            0.5.11-0.175.1.0.0.19.0    --- entire                                            0.5.11-0.175.1.0.0.18.0    --- entire                                            0.5.11-0.175.1.0.0.17.0    --- entire                                            0.5.11-0.175.1.0.0.16.0    --- entire                                            0.5.11-0.175.1.0.0.15.1    --- entire                                            0.5.11-0.175.1.0.0.14.0    --- entire                                            0.5.11-0.175.1.0.0.13.0    --- entire                                            0.5.11-0.175.1.0.0.12.0    --- entire                                            0.5.11-0.175.1.0.0.11.0    --- entire                                            0.5.11-0.175.1.0.0.10.0    --- entire                                            0.5.11-0.175.0.11.0.4.1    i--   --> this is at what level your OS is ! 3 ) Apply the latest SRU: (don´t forget the --accept parameter) # pkg update --accept entire-AT-0.5.11-0.175.1.0.0.24.2------------------------------------------------------------Package: pkg://solaris/consolidation/osnet/osnet-incorporation-AT-0.5.11,5.11-0.175.1.0.0.24.2:20120919T184141ZLicense: usr/src/pkg/license_files/lic_OTNOracle Technology Network Developer License AgreementOracle Solaris, Oracle Solaris Cluster and Oracle Solaris ExpressEXPORT CONTROLSSelecting the "Accept License Agreement" button is a confirmationof your agreement that you comply, now and during the trial term(if applicable), with each of the following statements:-You are not a citizen, national, or resident of, and are not undercontrol of, the government of Cuba, Iran, Sudan, North Korea, Syria,or any country to which the United States has prohibited export. <....> Packages to remove:  10 Packages to install:  38 Packages to update: 443 Mediators to change:   2 Create boot environment: Yes   --> a reboot is required and a new BE will be created for you !! Create backup boot environment:  No DOWNLOAD                               PKGS       FILES    XFER (MB)Completed                                491/491 23113/23113  504.2/504.2PHASE                                        ACTIONSRemoval Phase                           10359/10359 Install Phase                               15530/15530 Update Phase                              15543/15543 PHASE                                          ITEMSPackage State Update Phase         932/932 Package Cache Update Phase       452/452 Image State Update Phase                    2/2 A clone of solaris-1 exists and has been updated and activated.On the next boot the Boot Environment solaris-2 will bemounted on '/'.  Reboot when ready to switch to this updated BE. 4 ) Reboot your system # reboot  5 ) Resources Solaris 11 Express and Solaris 11 Support Repositories Explained [ID 1021281.1] Oracle Solaris 11 Release Notes Updating the Software on Your Oracle Solaris 11 System

    Read the article

  • How to enforce a namespace in wsdl for inner elements

    - by wsxedc
    I am looking at an example WSDL <definitions xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tns="http://mypackage/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/" targetNamespace="http://mypackage/" name="HelloService"> <types> <xsd:schema> <xsd:import namespace="http://mypackage/" schemaLocation="http://localhost:8081/HelloWebService/HelloService?xsd=1"> </xsd:import> </xsd:schema> </types> <message name="sayHello"> <part name="parameters" element="tns:sayHello"></part> </message> <message name="sayHelloResponse"> <part name="parameters" element="tns:sayHelloResponse"></part> </message> <portType name="Hello"> <operation name="sayHello"> <input message="tns:sayHello"></input> <output message="tns:sayHelloResponse"></output> </operation> </portType> <binding name="HelloPortBinding" type="tns:Hello"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" style="document"></soap:binding> <operation name="sayHello"> <soap:operation soapAction=""></soap:operation> <input> <soap:body use="literal"></soap:body> </input> <output> <soap:body use="literal"></soap:body> </output> </operation> </binding> <service name="HelloService"> <port name="HelloPort" binding="tns:HelloPortBinding"> <soap:address location="http://localhost:8081/HelloWebService/HelloService"> </soap:address> </port> </service> and the referenced xsd is <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:tns="http://mypackage/" xmlns:xs="http://www.w3.org/2001/XMLSchema" version="1.0" targetNamespace="http://mypackage/"> <xs:element name="sayHello" type="tns:sayHello"></xs:element> <xs:element name="sayHelloResponse" type="tns:sayHelloResponse"> </xs:element> <xs:complexType name="sayHello"> <xs:sequence> <xs:element name="arg0" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> <xs:complexType name="sayHelloResponse"> <xs:sequence> <xs:element name="return" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> </xs:schema> When I use SoapUI to generate a request message, it looks like this <soapenv:Envelope xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:myp="http://mypackage/"> <soapenv:Header/> <soapenv:Body> <myp:sayHello> <arg0>?</arg0> </myp:sayHello> </soapenv:Body> </soapenv:Envelope> My question is, why doesn't arg0 need a namespace like ?? I am just using this as an example as the element that are children of soapenv always have a namespace prefix, however, the children of these children do not have any prefix. This is the case with soapUI and message sent by Axis2 generated stubs. My questions are: 1. Why aren't there any namespace for arg0? 2. Is there a way to enforce myp prefix on arg0 from WSDL? If so, how? If not, why can't it be done?

    Read the article

< Previous Page | 787 788 789 790 791 792 793 794 795 796 797 798  | Next Page >