Search Results

Search found 51778 results on 2072 pages for 'super columns'.

Page 80/2072 | < Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >

  • Is it possible to not trigger my normal search highlighting when using search as a movement?

    - by Nathan Long
    When I do a search in vim, I like to have my results highlighted and super-visible, so I give them a bright yellow background and a black foreground in my .vimrc. " When highlighting search terms, make sure text is contrasting colors :highlight Search guibg=yellow guifg=black (This is for GUI versions of vim, like MacVim or Gvim; for command-line, you'd use ctermbg and ctermfg.) But I sometimes use search as a movement, as in c/\foo - "change from the cursor to the next occurrence of foo." In that case, I don't want all the occurrences of foo to be highlighted. Can I turn off highlighting in cases where search is used as a movement?

    Read the article

  • Different versions of 2.5" drives? Unscreawing Intel 320 for slimmer drive to fit newer thinkpads?

    - by hhh
    My x60s laptops come with about 1-2mm heigher 2.5" HDD than newer x220 models. This is totally stupid when one would like to reuse the old drive in the newer laptops. I bought newer 2.5" 320 Intel SSDs and they seem to have such 1-2mm gap to unscrew but I am unsure whether it is meant for opening. Could someone instruct what to do here? Look the manufacturer has started changing the old good 2.5" drives into slightly different versions, now it means slow compability issues to fix or totally new 2.5" drives. Ideas how to proceed? Unscrewing newer 320 drives or are some other versions of 2.5" drives meant for x220? Does there exist some sort of racks to get drives working between different comps? Perhaps booting from laplink is currently the easiest solution to get things working when changing harddrives between comps? Perhaps related http://www.zdnet.com/blog/hardware/seagate-announced-super-slim-25in-momentus-thin-hard-drive/6439

    Read the article

  • How can I make my browser(s) finish AJAX requests instead of stopping them when I switch to another page?

    - by Tom Wijsman
    I usually need to deal with things on a page right before switching to yet another page, this ranges from "liking / upvoting a comment or post" up to "an important action" and doesn't always come with feedback on whether the action actually proceeded. This is a huge problem! I assume the action to proceed once I start the particular AJAX request, but because I switch to another page it didn't actually happen because the AJAX request got aborted. This has left me several times with coming back to the page and seeing my action didn't take place at all; to give you an idea how bad this is, this even happened once when commenting on Super User! Is there a way to tell my browser to not drop these AJAX connections but simply let them finish?

    Read the article

  • Batch converting video from avc1 to xvid

    - by Tommy Brunn
    I need a way to batch convert 720p video files from avc1 to xvid in Ubuntu 10.04. I'm not terribly concerned about file size, but I do wish to retain the picture quality as much as possible. I believe the audio is encoded as aac, which is fine for my purposes. What would be the best and easiest way to do this? I've tried using Handbrake. During my first attempt, I had it using ffmpeg to convert to MPEG-4, but that just gave me a super-low quality video at twice the file size. Trying h.264 now, so we'll see how that works out. But just in case it doesn't pan out so well, what other ways do you recommend? I was thinking I'd write a bash script to reencode the files one by one, but the problem is that I have very little knowledge about codecs and containers and whatnot - so I wouldn't know what parameters I would pass ffmpeg/mencoder.

    Read the article

  • Using pivot tables to group transactions

    - by andreas
    I have my bank account statement and what I would like to do is group the descriptions of the transactions together with their debit or credit and sum their total. I could then see that, e.g., for ebay.com my total debit was $2000, etc. Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 What I want to do is use a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I am no able to do that, as I can't group the description and have additional debit and credit columns -- I get them all in rows with blanks.

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • Wireless Connection unstable with multiple devices connected

    - by KingIsulgard
    My wireless network works perfectly when only 1 device is connected. Super fast, full strength. But as soon as multiple devices are connected to the wireless network the connections become unstable (constantly losing connection with the internet, not the network itself). It's quite annoying. I have a Sitecom Wireless 300N XR Gigabit Router WL-306, which should be a decent router so I'm guessing there must be something wrong with my configuration. Does any of you know what might cause this? Thanks

    Read the article

  • Unique string values in range

    - by Dean Smith
    I have some spreadsheets where there are large number of cells that have essentially been used for free text. There is a finite set of values for this free text and most, if not all repeat. eg. A B C D 1 Monkey Gorilla Cat Dog 2 Dog Cat Gorilla Gorilla 3 Dog Dog Dog Cat There are probably 50 or so different cell values spread over multiple sheets and hundreds of rows and columns. I need to analyse this data and count occurancies, which is not a problem other than getting a list of unique values to start with and this has been driving me up the wall. What is the best way to produce this list. So from the above we would have Monkey Dog Cat Gorilla In order of preferred solutions, as this will need to be done monthly. Dynamic formula based VB Script Other ( Advanced filtering or other manual steps )

    Read the article

  • Are there any Spreadsheet apps that are as easy and powerful to use as Vim?

    - by ovatsug25
    I'd like to use a spreadsheet that lets me move around cells like I do in Vim. As well, the more commands that are attributed to keyboard shortcuts, the better. Particularly stuff like making Text-to-Columns which is one of my more frequently used features in Excel. I don't mind learning the shortcuts if they allow me to just look at the spreadsheet page and forget about everything else. edit: The way I am thinking about the Spreadsheet right now is as if every cell is its own unique file. There should be a command where I choose to open that file and edit it right on the spot within the view of the spreadsheet. So I guess I want different modes like in vim which have commands and there should be one mode that is hooked up just to do operations or formatting which would be similar to command mode in Vim.

    Read the article

  • How to download a URL as a file?

    - by Michelle
    A website URL has "hidden" some MP3 files by embedding them as Shockwave files, as follows. <span class="caption"><!-- Odeo player --><embed src="http://odeo.com/flash/audio_player_tiny_gray.swf"quality="high" name="audio_player_tiny_gray" align="middle" allowScriptAccess="always" wmode="transparent" type="application/x-shockwave-flash" flashvars="valid_sample_rate=true external_url=http://podcast.cbc.ca/mp3/sundayeditionstream_20081125_9524.mp3" pluginspage="http://www.macromedia.com/go/getflashplayer"></embed></span> How can I download the files for off-line listening? I've found two methods: 1. The Stack Overflow Method Create a new local HTML file with just the links, for example: <a href="http://podcast.cbc.ca/mp3/sundayeditionstream_20081125_9524.mp3">Sunday Edition 25Nov2008</a> Open the file in the browser, right click the link and File Save Link As. 2. The Super User Method Install the Firefox addin Iget. (Be sure to use the right version for your Firefox version.) Tools Downloads Enter URL in the field. Are there any other ways?

    Read the article

  • How can I combine 30,000 images into a timelapse movie?

    - by Swift
    I have taken 30,000 still images that I want to combine into a timelapse movie. I have tried QuickTime Pro, TimeLapse 3, and Windows Movie Maker, but with such a huge amount of images, each of the programs fail (I tried SUPER ©, but couldn't get it to work either...?). It seems that all of these programs crash after a few thousand pictures. The images I have are all in .JPG format, at a resolution of 1280x800, and I'm looking for a program that can put these images into a timelapse movie in some kind of lossless format (raw/uncompressed AVI would be fine) for further editing. Does anyone have any ideas, or has anyone tried anything like this with a similar number of pictures?

    Read the article

  • Odd SVN Checkout failures occur frequenctly on VMWare virtual machines

    - by snowballhg
    We've recently been experiencing seemingly random SVN checkout failures on our Hudson build system. Google search has failed me; I'm hoping the super user community can help me out :-) We are occasionally receiving the following SVN error when our Hudson build jobs checkout source via the Hudson Subversion plug-in (which uses svn kit): ERROR: Failed to check out http://server/svnroot/trunk org.tmatesoft.svn.core.SVNException: svn: Processing REPORT request response failed: XML document structures must start and end within the same entity. (/svnroot/!svn/vcc/default) svn: REPORT request failed on '/svnroot/!svn/vcc/default' This issue seems to only occur when checking out from our Virtual Machines (Windows XP, Fedora 9, Fedora 12) using Hudson's SVN Plug-in. Systems that use the traditional SVN client seem to work. SVN Server version: 1.6.6 Hudson version: 1.377 Hudson SVN Plugin Version: 1.17 Has anyone dealt with this issue, or have any suggestions? Thanks

    Read the article

  • Internet connection too slow

    - by user23950
    I now think that it is the ISP. After a full scan of my system. With super antispyware, avast, norton and spybot. Internet connection is still slow. And the truth is we have recently upgraded the connection from 512 kbps to 768. And I get a .25 Mbps at speedtest.net which is equivalent to 256 Kbps. Its not even half of the advertised speed. Is it normal for ISP's to just limit your bandwidth if you are always downloading something from the internet? Are they entitled to do this.

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • How can I combine 30,000 images into a timelapse movie?

    - by Swift
    I have taken 30,000 still images that I want to combine into a timelapse movie. I have tried QuickTime Pro, TimeLapse 3, and Windows Movie Maker, but with such a huge amount of images, each of the programs fail (I tried SUPER ©, but couldn't get it to work either...?). It seems that all of these programs crash after a few thousand pictures. The images I have are all in .JPG format, at a resolution of 1280x800, and I'm looking for a program that can put these images into a timelapse movie in some kind of lossless format (raw/uncompressed AVI would be fine) for further editing. Does anyone have any ideas, or has anyone tried anything like this with a similar number of pictures?

    Read the article

  • Enlarge partition on SD card

    - by chenwj
    I have followed Cloning an SD card onto a larger SD card to clone a 2G SD card to a 32G SD card, and the file system is ext4. However, on the 32G SD card I only can see 2G space available. Is there a way to maximize it out? Here is the output of fdisk: Command (m for help): p Disk /dev/sdb: 32.0 GB, 32026656768 bytes 64 heads, 32 sectors/track, 30543 cylinders, total 62552064 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000e015a Device Boot Start End Blocks Id System /dev/sdb1 * 32 147455 73712 c W95 FAT32 (LBA) /dev/sdb2 147456 3994623 1923584 83 Linux I want to make /dev/sdb2 use up the remaining space. I try resize2fs /dev/sdb after dd, but get message below: $ sudo resize2fs /dev/sdb resize2fs 1.42 (29-Nov-2011) resize2fs: Bad magic number in super-block while trying to open /dev/sdb Couldn't find valid filesystem superblock. Any idea on what I am doing wrong? Thanks.

    Read the article

  • BSOD doing wireless connection repair

    - by Kb
    (This should maybe be asked on Super User, but currently it is only for beta users.) We have a Dell Latitude X1 which always gets a BSOD (page fault in non page area) after repair on wireless. Wireless works as long as we do not do repair. Have tried the following with no success: Have updated BIOS to latest version and updated drivers for Intel wireless to the latest version. Any other suggestions? For now we just do not do repair and maybe that is the solution?

    Read the article

  • Pivot tables in excel

    - by andreas
    Hey GUYS i have my account bank account statement and what i wanna do is group the description oof transactions together with their debit or credit and sum their total . So that i can see that for ebay.com my total debit was 2000 $ etc... no the data are like this (btw how do you format this?) Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 ETC.... what i wanna do is using a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I can seem to be able to do that as i cant group the description and have additional debit and credit columns.....as i get them all in rows with blanks

    Read the article

  • Help recovering lost text from a refreshed Chrome webpage (it was in the clipboard as well)? [closed]

    - by tobeannounced
    Possible Duplicate: Chrome: where is the location to save browse temporary files Ok, so here's what happened - and yes, it was pretty stupid by me: I wrote up and submitted a post on Stack Overflow It was not suited to be placed on Stack Overflow as someone pointed out to me, so I deleted the post (this was a few hours ago) I copied the text into a new question page on Super User, but didn't submit it yet I accidentally just refreshed the webpage that had the text, and the question has now been deleted from Stack Overflow I have Lazarus installed, however the Chrome version doesn't have many features and the text was not recoverable from there. I do not have a clipboard manager, but the text was copied to my clipboard - so is there any way to get this back (Windows 7)? Although the post on Stack Overflow was deleted, I suppose it would have existed in my cache - could I recover it from there? Would the post on Stack Overflow exist in an rss feed anywhere? Many thanks, and I hope I can find this - and I am sure that the solution will prove valuable for me (and others) in the not too distant future once again.

    Read the article

  • Source File not updating Destination Files in Excel

    - by user127105
    I have one source file that holds all my input costs. I then have 30 to 40 destination files (costing sheets) that use links to data in this source file for their various formulae. I was sure when I started this system that any changes I made to the source file, including the insertion of new rows and columns was updated automatically by the destination files, such that the formula always pulled the correct input costs. Now all of a sudden if my destination files are closed and I change the structure of the source file by adding rows - the destination files go haywire? They pick up changes to their linked cells, but don't pick up changes to the source sheet that have shifted their relative positions in the sheet. Do I really need to open all 40 destination files at the same time I alter the source file structure? Further info: all the destination files are protected, and I am working on DropBox.

    Read the article

  • Slot load DVD burner options for standard desktop case

    - by Michael Kohne
    I need a new DVD burner (internal) for my father-in-law's computer. He's apparently broken the current one - he forgot to push the tray back in after doing something and hit it with his chair. Given this, I'd like to get him a slot-loading DVD burner, so as to avoid the problem entirely. I need an internal device, and I'll be mounting in a 5 1/4" bay. He doesn't need any super-spec device - as long as it can read/write all the standard formats, it's good. I see a few options at newegg.com, but they all have mixed reviews. Are there any out there that are generally seen as reliable? How does one go about mounting slimline devices in a standard 5 1/4" bay? Is there a standard faceplate kit for that?

    Read the article

  • Change filtering method used by Firefox when zooming

    - by peak
    I often zoom in a step or two when reading long texts in Firefox, but when I do so the images become super blurry. It's not really a big deal but when reading text on images (mathematical equations mostly), it's a bit distracting. It seems as if they are scaled using only bilinear interpolation. If I scale an image the same amount in for example Paint.NET or Photoshop the result is much better. Is there any way to change the filtering method used by Firefox to bicubic or another better method? I am Using Firefox 3.5 on Windows BTW.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • How change the layout (e.g. background-color) of autoplaylists in foobar2000?

    - by UdeF
    A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

    Read the article

< Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >