Search Results

Search found 64995 results on 2600 pages for 'data import'.

Page 803/2600 | < Previous Page | 799 800 801 802 803 804 805 806 807 808 809 810  | Next Page >

  • Cakephp - Banner Problem

    - by Joe Elliott
    Hi guys I have a banner rotator on my main page and it was working but it has stopped. All I have done before it stopped was modified some of the db fields. I added to fields position and company and deleted the field 'description.' It was a friend of a friend that made this part of the site for me while i was on holiday so i dont know which files i should show you cos dont know exactly what hes done but im guessing the following ones are the ones you need. banner_view <div id="banner"> <?php if(!empty($banners) && ($banners['Banner']['position']=='Top')){ foreach($banners as $banner){ ?> <a href="<?php echo $banner['Banner']['url']; ?>"><img src="<?php echo $banner['Banner']['path']; ?>" alt="<?php echo $banner['Banner']['company']; ?>" /></a> <?php } } ?> </div> banner_controller <?php class BannersController extends AppController { var $name = 'Banners'; var $helpers = array('Html', 'Form', 'Ajax','Javascript'); var $layout = 'ajax'; var $components = array('Session', 'Cookie'); function beforeFilter() { parent::beforeFilter(); $this->Auth->allow('index','featrot'); if(strpos($this->here, 'admin')) { $this->layout = 'admin'; } } function index() { Configure::write('debug',0); $this->Banner->recursive = 0; $this->paginate['Banner']; $banners = $this->paginate(); if($banners) { $this->set('banners', $banners); } } function featrot() { Configure::write('debug',0); $this->Banner->recursive = 0; $this->paginate['Banner']; $banners = $this->paginate(); if($banners) { $this->set('banners', $banners); } } function admin_edit(){ $this->pageTitle='Admin section - .: Banners Edit:.'; $banners = $this->Banner->find('first'); $id = $banners['Banner']['id']; if (!empty($this->data)) { $this->Banner->id = $id; if ($this->Banner->save($this->data)) { $this->Session->setFlash(__('The Banner has been updated', true)); } else { $this->Session->setFlash(__('The Banner could not update. Please, try again.', true)); } } if (empty($this->data)) { $this->data = $this->Banner->read(null, $id); } } function admin_display_banners($id=null){ $this->pageTitle='Admin section - .: Banners Setting :.'; if (!empty($this->data)) { $this->Banner->id = $id; if ($this->Banner->save($this->data)) { $this->Session->setFlash(__("Banner#$id has been updated", true)); $this->Banner->id = null; } else { $this->Session->setFlash(__("Banner#$id could not update. Please, try again.", true)); } } $this->data = null; $this->Banner->recursive = -1; $this->paginate['Banner']; $banners = $this->paginate('Banner'); $this->set('banners', $banners); } } ?> banner_model <?php class Banner extends AppModel { var $name = 'Banner'; } ?> Hope this is all the details you need. Thanks in advance folks :) Joe :)

    Read the article

  • The confusion on python encoding

    - by zhangzhong
    I retrieved the data encoded in big5 from database,and I want to send the data as email of html content, the code is like this: html += """<tr><td>""" html += """unicode(rs[0], 'big5')""" # rs[0] is data encoded in big5 I run the script, but the error raised: UnicodeDecodeError: 'ascii' codec can't decode byte...... However, I tried the code in interactive python command line, there are no errors raised, could you give me the clue?

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • Recommendations for a google finance-like interactive chart control

    - by Chris Farmer
    I need some sort of interactive chart control for my .NET-based web app. I have some wide XY charts, and the user should be able to interactively scroll and zoom into a specific window on the x axis. Something that acts similar to the google finance control would be nice, but without the need for the date labels or the news event annotations. Also, I'd prefer to avoid Flash, if that's even possible. Can someone please give some recommendations of something that might come close? EDIT: the "real" google timeline visualization is for date-based data. I just have numeric data. I tried to use that control for non-date data, but it seems to always want to show a date and demands that the first data column actually be a date.

    Read the article

  • Communicate between content script and options page

    - by Gaurang Tandon
    I have seen many questions already and all are about background page to content script. Summary My extension has an options page, and a content script. The content script handles the storage functionality (chrome.storage manipulation). Whenever, a user changes a setting in the options page, I want to send a message to the content script to store the new data. My code: options.js var data = "abcd"; // let data chrome.tabs.query({ active: true, currentWindow: true }, function (tabs) { chrome.tabs.sendMessage(tabs[0].id, "storeData:" + data, function(response){ console.log(response); // gives undefined :( }); }); content script js chrome.runtime.onMessage.addListener(function(request, sender, sendResponse) { // not working }); My question: Why isn't the approach not working? Is there any other (better) approach for this procedure.

    Read the article

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • Error in glmmadmb(.....) The function maximizer failed (couldn't find STD file)

    - by Joe King
    This works fine: fit.mc1 <-MCMCglmm(bull~1,random=~school,data=dt1,family="categorical", prior=list(R=list(V=1, fix=1), G=list(G1=list(V=1, nu=0))), slice=T) So does this: fit.glmer <- glmer(bull~(1|school),data=dt1,family=binomial) But now I am trying to work with the package glmmadmb and this does not work: fit.mc12 <- glmmadmb(bull~1+(1|school), data=dt1, family="binomial", mcmc=TRUE, mcmc.opts=mcmcControl(mcmc=50000)) It generates the error: Error in glmmadmb(bull~ 1 + (1 | school), data = dt1, family = "binomial", : The function maximizer failed (couldn't find STD file) In addition: Warning message: running command '<snip>\cmd.exe <snip>\glmmadmb.exe" -maxfn 500 -maxph 5 -noinit -shess -mcmc 5000 -mcsave 5 -mcmult 1' had status 1

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Nice, clean, simple way of getting a dataset from ASP.NET to plain HTML jQuery or JavaScript library

    - by David S
    I know this is a probable open ended question, and I have tried looking around so much over the last year or two... maybe I am looking for a perfect place that doesn't exist! of course it's all about perception no less.. Anyway, just to clarify what I am trying to do and why: I want to be able to use (primarily for the moment) ASP.NET or services thereof to get a dataset - whatever the source data, I can obviously get a dataset of rows/Columns. I want to be able to, as simply as possible, get that data over to the client via xml/json/whatever, to then use in a "variety" of ways. "Variety" of ways meaning I would like to "easily" bind that data to say a grid, or a combo dropdown or just simply render to a textbox - BUT by referencing the dataset as I would say on the serverside. Now I know this all sounds simplistic, and I know there are lots of complications.. so I have tried the following so far over the last year or so: ExtJS - very good, nice solid framework, but just found it a bit too much to use in everyday basic apps - great if I was building a whole application with it Yahoo YUI - not looked recently, but I guess some of the concepts with ExtJS were similar? JQuery - of course to get data etc, it was ok, and I guess there are so many 3rd party plugins, that a mix and match might work? Adobe SPRY - ironically this was as close to getting a dataset style structure to Javascript/client, although it seemed to drop off/go quiet..? I maybe wrong.. I did have a very cursory play with Tibco GI and another one I cannot remember the name of! but again, it felt like it was great to build a whole app perhaps? Anyway, I am very amazed by all of the technologies coming out, and really not biased one way or the other, I really just want a very simple way of getting data from the server, and having a basic/very flexible way of working with that data in the client without using server technologies.. I need to keep the server flexible as I may need to use PHP, or java technologies not just .NET So again, sorry for the rambles, but if anyone out there has had a simple experience, or would like to share some ideas, it would be very welcomed!! David.

    Read the article

  • FIFO dequeueing in python?

    - by Aaron Ramsey
    hello again everybody— I'm looking to make a functional (not necessarily optimally efficient, as I'm very new to programming) FIFO queue, and am having trouble with my dequeueing. My code looks like this: class QueueNode: def __init__(self, data): self.data = data self.next = None def __str__(self): return str(self.data) class Queue: def__init__(self): self.front = None self.rear = None self.size = 0 def enqueue(self, item) newnode = QueueNode(item) newnode.next = None if self.size == 0: self.front = self.rear = newnode else: self.rear = newnode self.rear.next = newnode.next self.size = self.size+1 def dequeue(self) dequeued = self.front.data del self.front self.size = self.size-1 if self.size == 0: self.rear = None print self.front #for testing if I do this, and dequeue an item, I get the error "AttributeError: Queue instance has no attribute 'front'." I guess my function doesn't properly assign the new front of the queue? I'm not sure how to fix it though. I don't really want to start from scratch, so if there's a tweak to my code that would work, I'd prefer that—I'm not trying to minimize runtime so much as just get a feel for classes and things of that nature. Thanks in advance for any help, you guys are the best.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to load a springframework ApplicationContext from Jython

    - by staticman
    I have a class that loads a springframework application context like so: package com.offlinesupport; import org.springframework.context.ApplicationContext; import org.springframework.context.support.ClassPathXmlApplicationContext; public class OfflineScriptSupport { private static ApplicationContext appCtx; public static final void initialize() { appCtx = new ClassPathXmlApplicationContext( new String[] { "mycontext.spring.xml" } ); } public static final ApplicationContext getApplicationContext() { return appCtx; } public static final void main( String[] args ) { System.out.println( "Starting..." ); initialize(); System.out.println( "loaded" ); } } The class OfflineScriptSupport, and the file mycontext.spring.xml are each deployed into separate jars (along with other classes and resources in their respective modules). Lets say the jar files are OfflineScriptSupport.jar and *MyContext.jar". mycontext.spring.xml is put at the root of the jar. In a Jython script (*myscript.jy"), I try to call the initialize method to create the application context: from com.offlinesupport import OfflineScriptSupport OfflineScriptSupport.initialize(); I execute the Jython script with the following command (from Linux): jython -Dpython.path=spring.jar:OfflineScriptSupport.jar:MyContext.jar myscript.jy The Springframework application context cannot find the mycontext.spring.xml file. It displays the following error: java.io.FileNotFoundException: class path resource [mycontext.spring.xml] cannot be opened because it does not exist at org.springframework.core.io.ClassPathResource.getInputStream(ClassPathResource.java:137) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:167) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:148) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:126) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:142) at org.springframework.context.support.AbstractXmlApplicationContext.loadBeanDefinitions(AbstractXmlApplicationContext.java:113) at org.springframework.context.support.AbstractXmlApplicationContext.loadBeanDefinitions(AbstractXmlApplicationContext.java:81) at org.springframework.context.support.AbstractRefreshableApplicationContext.refreshBeanFactory(AbstractRefreshableApplicationContext.java:89) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:269) at org.springframework.context.support.ClassPathXmlApplicationContext.<init>(ClassPathXmlApplicationContext.java:87) at org.springframework.context.support.ClassPathXmlApplicationContext.<init>(ClassPathXmlApplicationContext.java:72) at com.offlinesupport.OfflineScriptSupport.initialize(OfflineScriptSupport.java:27) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) If I run the jar directly from Java (using the main entry point in OfflineScriptSupport) it works and there is no error thrown. Is there something special about the way Jython handles classpaths making the Springframework's ClassPathXmlApplicationContext not work (i.e. not be able to find resource files in the classpath)?

    Read the article

  • how to change file permissions in postfix ?

    - by Zdanozdan
    Hi, In the postfix main.cf I have configured service to invoke external php script. smtp inet n - - - - smtpd -o content_filter=myservice:www-data myservice unix - n n - 1 pipe flags=Rq user=me null_sender= argv=/home/me/my_script.php so far so good, my_script.php is executed. It creates the file my_file.txt in home dir. However I can only manage -rw------- 1 me www-data 16 2009-10-11 19:35 my_file.txt How do I add 'r' permissions for www-data group ?

    Read the article

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • Redundancy algorithm for reading noisy bitstream

    - by Tedd Hansen
    I'm reading a lossy bit stream and I need a way to recover as much usable data as possible. There can be 1's in place of 0's and 0's in palce of 1's, but accuracy is probably over 80%. A bonus would be if the algorithm could compensate for missing/too many bits as well. The source I'm reading from is analogue with noise (microphone via FFT), and the read timing could vary depending on computer speed. I remember reading about algorithms used in CD-ROM's doing this in 3? layers, so I'm guessing using several layers is a good option. I don't remember the details though, so if anyone can share some ideas that would be great! :) Edit: Added sample data Best case data: in: 0000010101000010110100101101100111000000100100101101100111000000100100001100000010000101110101001101100111000101110000001001111011001100110000001001100111011110110101011100111011000100110000001000010111 out: 0010101000010110100101101100111000000100100101101100111000000100100001100000010000101110101001101100111000101110000001001111011001100110000001001100111011110110101011100111011000100110000001000010111011 Bade case (timing is off, samples are missing): out: 00101010000101101001011011001110000001001001011011001110000001001000011000000100001011101010011011001 in: 00111101001011111110010010111111011110000010010000111000011101001101111110000110111011110111111111101 Edit2: I am able to controll the data being sent. Currently attempting to implement simple XOR checking (though it won't be enough).

    Read the article

  • Is there any live video stream editing open source project with API for my needs?

    - by Ole Jak
    I need an open source project with an API capable of reading a live video stream (stream codec can be any API can read - I can provide with practically any live streamable one) giving me last image data for some processing (like brightness\contrast or more exotic filtering) being able to receive data I've changed and starting to stream that data on to some http://localhost:port/ in some format I need it to be easily accessible from C# (even better, written in C#).

    Read the article

  • Can Git or Mercurial be set to bypass the local repository and go straight to the central one?

    - by Jian Lin
    Using Git or Mercurial, if the working directory is 1GB, then the local repository will be another 1GB (at least), residing normally in the same hard drive. And then when pushed to a central repository, there will be another 1GB. Can Git or Mercurial be set to use only a working directory and then a central repository, without having 3 copies of this 1GB data? (actually, when the central repository also update, then there are 4 copies of the same data... can it be reduced? In the SVN scenario, when there are 5 users, then there will be 6GB of data total. With Distributed Version Control, then there will be 12GB of data?)

    Read the article

  • Multi-part template issue with Jinja2

    - by Alan Harris-Reid
    Hi, When creating templates I typically have 3 separate parts (header, body, footer) which I combine to pass a singe string to the web-server (CherryPy in this case). My first approach is as follows... from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template('Body.html') page_body = tmpl.render() tmpl = env.get_template('Header.html') page_header = tmpl.render() tmpl = env.get_template('Footer.html') page_footer = tmpl.render() page_code = page_header + page_body + page_footer but this contains repetitious code, so my next approach is... def render_template(html_file): from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template(html_file) return tmpl.render() page_header = render_template('Header.html') page_body = render_template('Body.html') page_footer = render_template('Footer.html) However, this means that each part is created in its own environment - can that be a problem? Are there any other downsides to this approach? I have chosen the 3-part approach over the child-template approach because I think it may be more flexible (and easier to follow), but I might be wrong. Anyone like to convince me that using header, body and footer blocks might be better? Any advice would be appreciated. Alan

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • R: Why does read.table stop reading a file?

    - by Mike Dewar
    I have a file, called genes.txt, which I'd like to become a data.frame. It's got a lot of lines, each line has three, tab delimited fields: mike$ wc -l genes.txt 42476 genes.txt I'd like to read this file into a data.frame in R. I use the command read.table, like this: genes = read.table( genes_file, sep="\t", na.strings="-", fill=TRUE, col.names=c("GeneSymbol","synonyms","description") ) Which seems to work fine, where genes_file points at genes.txt. However, the number of lines in my data.frame is significantly less than the number of lines in my text file: > nrow(genes) [1] 27896 and things I can find in the text file: mike$ grep "SELL" genes.txt SELL CD62L|LAM1|LECAM1|LEU8|LNHR|LSEL|LYAM1|PLNHR|TQ1 selectin L don't seem to be in the data.frame > grep("SELL",genes$GeneSymbol) integer(0) it turns out that genes = read.delim( genes_file, header=FALSE, na.strings="-", fill=TRUE, col.names=c("GeneSymbol","synonyms","description"), ) works just fine. Why does read.delim work when read.table not? If it's of use, you can recreate genes.txt using the following commands which you should run from a command line curl -O ftp://ftp.ncbi.nlm.nih.gov/gene/DATA/gene_info.gz gzip -cd gene_info.gz | awk -Ft '$1==9606{print $3 "\t" $5 "\t" $9}' > genes.txt be warned, though, that gene_info.gz is 101MBish.

    Read the article

  • Testing ASP.NET security in Firefox

    - by blahblah
    I'm not sure whether this question belongs on StackOverflow or SuperUser, but here goes nothing... I'm trying to test out some basic security problems on my personal ASP.NET website to see exactly how the custom validators, etc. work when tampering with the data. I've been looking at the Firefox extension TamperData which seems to do the trick, but it doesn't feel very professional at all. The issues I'm having with TamperData is that the textbox for the POST data is way too small to hold the ASP.NET view-state, so I have to copy that data into Emacs and then back again to be productive at all. I also don't like that there doesn't seem to be an option to only tamper with data which is from/to localhost. Any ideas on better extensions for the task or better methods to test it?

    Read the article

  • Enable PyGTK Eventbox motion-notify-event while is a Layout child

    - by mkotechno
    I noticed when a Eventbox is added into a Layout some events are missed, this does not happend for example adding it to a Fixed (very similar widget), I tried to restore the event mask in this way with no sucess: import pygtk import gtk def foo(widget, event): print event pygtk.require('2.0') window = gtk.Window(gtk.WINDOW_TOPLEVEL) window.connect('destroy', lambda x: gtk.main_quit()) eventbox = gtk.EventBox() eventbox.connect('button-press-event', foo) # works eventbox.connect('motion-notify-event', foo) # fail eventbox.set_events( gtk.gdk.BUTTON_MOTION_MASK| # restoring missed masks gtk.gdk.BUTTON1_MOTION_MASK| gtk.gdk.BUTTON2_MOTION_MASK| gtk.gdk.BUTTON3_MOTION_MASK) layout = gtk.Layout() image = gtk.image_new_from_file('/home/me/picture.jpg') layout.add(image) eventbox.add(layout) window.add(eventbox) window.show_all() gtk.main() How should I restore the missed event/mask?

    Read the article

  • MySQL Column Value Pivot

    - by manyxcxi
    I have a MySQL InnoDB table laid out like so: id (int), run_id (int), element_name (varchar), value (text), line_order, column_order `MyDB`.`MyTable` ( `id` bigint(20) NOT NULL, `run_id` int(11) NOT NULL, `element_name` varchar(255) NOT NULL, `value` text, `line_order` int(11) default NULL, `column_order` int(11) default NULL It is used to store data generated by a Java program that used to output this in CSV format, hence the line_order and column_order. Lets say I have 2 entries (according to the table description): 1,1,'ELEMENT 1','A',0,0 2,1,'ELEMENT 2','B',0,1 I want to pivot this data in a view for reporting so that it would look like more like the CSV would, where the output would look this: --------------------- |ELEMENT 1|ELEMENT 2| --------------------- | A | B | --------------------- The data coming in is extremely dynamic; it can be in any order, can be any of over 900 different elements, and the value could be anything. The Run ID ties them all together, and the line and column order basically let me know where the user wants that data to come back in order.

    Read the article

  • Twitter json output

    - by Bunny Rabbit
    $(function(){ $.ajax({ url:'http://api.twitter.com/1/statuses/user_timeline.json?screen_name=user_name&callback=?', //dataType:'json', success:function(data){$('body').append('the data is' +data);} }); }); the above code with dataType line prints out [objects] while with the dataType line commented it prints out nothing ...how can i get it to print the json output from the server rather then the javascript object?

    Read the article

< Previous Page | 799 800 801 802 803 804 805 806 807 808 809 810  | Next Page >