Search Results

Search found 56237 results on 2250 pages for 'parse error'.

Page 82/2250 | < Previous Page | 78 79 80 81 82 83 84 85 86 87 88 89  | Next Page >

  • Methodology To Determine Cause Of User Specific Error

    - by user3163629
    We have software that for certain clients fails to download a file. The software is developed in Python and compiled into an Windows Executable. The cause of the error is still unknown but we have established that the client has an active internet connection. We suspect that the cause is due to the clients network setup. This error cannot be replicated in house. What technique or methodology should be applied to this kind of specific error that cannot be replicated in house. The end goal is to determine the cause of this error so we can move onto the solution. For example; Remote Debugging: Produce a debug version of the software and ask the client to send back a debug output file. This involves alot of time (back and forth communication) and requires the client to work and act in a timely manor to be successful. In-house debugging: Visit the client and determine their network setup, etc. Possibly develop a series of script tests before hand to run on the clients computer under the same network. Other methodologies and techniques I am not aware of?

    Read the article

  • when I type apt-get -f install, I get the error message

    - by gene
    xserver-xorg-core (2:1.11.4-0ubuntu10.8) breaks xserver-xorg-video-5 and is installed. Also I can not upgrade my software, It said that the package system is broken, with detail information: The following packages have unmet dependencies: xserver-xorg-core: Depends: xserver-common (>= 2:1.11.4-0ubuntu10.8) but 2:1.11.4-0ubuntu10.8 is installed when I issue sudo apt-get update, the output seems fine the source is(sorry the output has too many links that I can not post in);http://archive.ubuntu.com Reading package lists... Done ====================== when I issue sudo apt-get dist-upgrade, the output is: Reading package lists... Done Building dependency tree Reading state information... Done You might want to run 'apt-get -f install' to correct these. The following packages have unmet dependencies: xserver-xorg-core : Breaks: xserver-xorg-video-5 E: Unmet dependencies. Try using -f. ================== when I issue 'sudo apt-get -f install', the output is: dpkg: dependency problems prevent configuration of xserver-xorg-video-radeon: xserver-xorg-core (2:1.11.4-0ubuntu10.8) breaks xserver-xorg-video-5 and is installed. xserver-xorg-video-radeon (1:6.12.1-0ubuntu2) provides xserver-xorg-video-5. dpkg: error processing xserver-xorg-video-radeon (--configure):dependency problems leaving unconfigured No apport report written because the error message indicates its a followup error from a previous failure. Errors were encountered while processing: xserver-xorg-video-radeon E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • "Programming error" exceptions - Is my approach sound?

    - by Medo42
    I am currently trying to improve my use of exceptions, and found the important distinction between exceptions that signify programming errors (e.g. someone passed null as argument, or called a method on an object after it was disposed) and those that signify a failure in the operation that is not the caller's fault (e.g. an I/O exception). As far as I understand, it makes little sense for an immediate caller to actually handle programming error exceptions, he should instead assure that the preconditions are met. Only "outer" exception handlers at task boundaries should catch them, so they can keep the system running if a task fails. In order to ensure that client code can cleanly catch "failure" exceptions without catching error exceptions by mistake, I create my own exception classes for all failure exceptions now, and document them in the methods that throw them. I would make them checked exceptions in Java. Now I have a few questions: Before, I tried to document all exceptions that a method could throw, but that sometimes creates an unwiedly list that needs to be documented in every method up the call chain until you can show that the error won't happen. Instead, I document the preconditions in the summary / parameter descriptions and don't even mention what happens if they are not met. The idea is that people should not try to catch these exceptions explicitly anyway, so there is no need to document their types. Would you agree that this is enough? Going further, do you think all preconditions even need to be documented for every method? For example, calling methods in IDisposable objects after calling Dispose is an error, but since IDisposable is such a widely used interface, can I just assume a programmer will know this? A similar case is with reference type parameters where passing null makes no conceivable sense: Should I document "non-null" anyway? IMO, documentation should only cover things that are not obvious, but I am not sure where "obvious" ends.

    Read the article

  • receiving "command not found" error messages after fresh reinstall of Lubuntu 14.04

    - by user236378
    Lubuntu 14.04 was working really great. . .until I messed up and had to do a complete fresh reinstall. Now I receive error messages when I input commands into the Terminal, even after immediately completing the fresh install. For example I type: sudo leafpad ?/etc/default/ or sudo leafpad ?/etc/default/grub I get: sudo: leafpad: command not found I type: sudo update-initramfs ?-u or sudo update-grub I get: sudo: update-initramfs: command not found or sudo: update-grub: command not found If I use the command mkdir I get: mkdir: command not found I also get this same exact error message, command not found, with sudo apt-get and wget In other words I can't do anything that I was able to do when inputting commands into the terminal. So I cannot add any repositories or update anything at all. I am not really sure what is causing the problem(s). It appeared to me that Lubuntu installed and booted up OK. However just as soon as I enter anything into the Terminal I immediately get the above error messages. I have tried to do the reinstall three times, same error messages. If anyone can suggest any fixes I would really appreciate it very much. Thank you!

    Read the article

  • Kubuntu apt-get -f install error

    - by ShaggyInjun
    I am seeing an error while running apt-get -f install. Can somebody help me out .. venkat@ubuntu:~/Downloads$ sudo apt-get -f install Reading package lists... Done Building dependency tree Reading state information... Done Correcting dependencies... Done The following extra packages will be installed: libjack-jackd2-0 Suggested packages: jackd2 The following packages will be upgraded: libjack-jackd2-0 1 upgraded, 0 newly installed, 0 to remove and 256 not upgraded. 109 not fully installed or removed. Need to get 0 B/197 kB of archives. After this operation, 3,072 B of additional disk space will be used. Do you want to continue [Y/n]? Y (Reading database ... 274641 files and directories currently installed.) Preparing to replace libjack-jackd2-0 1.9.8~dfsg.1-1ubuntu1 (using .../libjack-jackd2- 0_1.9.8~dfsg.2-1precise1_amd64.deb) ... Unpacking replacement libjack-jackd2-0 ... dpkg: error processing /var/cache/apt/archives/libjack-jackd2-0_1.9.8~dfsg.2- 1precise1_amd64.deb (--unpack): './usr/share/doc/libjack-jackd2-0/buildinfo.gz' is different from the same file on the system dpkg-deb: error: subprocess paste was killed by signal (Broken pipe) Errors were encountered while processing: /var/cache/apt/archives/libjack-jackd2-0_1.9.8~dfsg.2-1precise1_amd64.deb E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • Zend_Validate_Abstract custom validator not displaying correct error messages.

    - by Jeremy Dowell
    I have two text fields in a form that I need to make sure neither have empty values nor contain the same string. The custom validator that I wrote extends Zend_Validate_Abstract and works correctly in that it passes back the correct error messages. In this case either: isEmpty or isMatch. However, the documentation says to use addErrorMessages to define the correct error messages to be displayed. in this case, i have attached ->addErrorMessages(array("isEmpty"=>"foo", "isMatch"=>"bar")); to the form field. According to everything I've read, if I return "isEmpty" from isValid(), my error message should read "foo" and if i return "isMatch" then it should read "bar". This is not the case I'm running into though. If I return false from is valid, no matter what i set $this-_error() to be, my error message displays "foo", or whatever I have at index[0] of the error messages array. If I don't define errorMessages, then I just get the error code I passed back for the display and I get the proper one, depending on what I passed back. How do I catch the error code and display the correct error message in my form? The fix I have implemented, until I figure it out properly, is to pass back the full message as the errorcode from the custom validator. This will work in this instance, but the error message is specific to this page and doesn't really allow for re-use of code. Things I have already tried: I have already tried validator chaining so that my custom validator only checks for matches: ->setRequired("true") ->addValidator("NotEmpty") ->addErrorMessage("URL May Not Be Empty") ->addValidator([*customValidator]*) ->addErrorMessage("X and Y urls may not be the same") But again, if either throws an error, the last error message to be set displays, regardless of what the error truly is. I'm not entirely sure where to go from here. Any suggestions?

    Read the article

  • Parse and read data frame in C?

    - by user253656
    I am writing a program that reads the data from the serial port on Linux. The data are sent by another device with the following frame format: |start | Command | Data | CRC | End | |0x02 | 0x41 | (0-127 octets) | | 0x03| ---------------------------------------------------- The Data field contains 127 octets as shown and octet 1,2 contains one type of data; octet 3,4 contains another data. I need to get these data I know how to write and read data to and from a serial port in Linux, but it is just to write and read a simple string (like "ABD") My issue is that I do not know how to parse the data frame formatted as above so that I can: get the data in octet 1,2 in the Data field get the data in octet 3,4 in the Data field get the value in CRC field to check the consistency of the data Here the sample snip code that read and write a simple string from and to a serial port in Linux: int writeport(int fd, char *chars) { int len = strlen(chars); chars[len] = 0x0d; // stick a <CR> after the command chars[len+1] = 0x00; // terminate the string properly int n = write(fd, chars, strlen(chars)); if (n < 0) { fputs("write failed!\n", stderr); return 0; } return 1; } int readport(int fd, char *result) { int iIn = read(fd, result, 254); result[iIn-1] = 0x00; if (iIn < 0) { if (errno == EAGAIN) { printf("SERIAL EAGAIN ERROR\n"); return 0; } else { printf("SERIAL read error %d %s\n", errno, strerror(errno)); return 0; } } return 1; } Does anyone please have some ideas? Thanks all.

    Read the article

  • Getting bizarre "expected primary-expression" error.

    - by Fecal Brunch
    Hi, I'm getting a really strange error when making a method call: /* input.cpp */ #include <ncurses/ncurses.h> #include "input.h" #include "command.h" Input::Input () { raw (); noecho (); } Command Input::next () { char input = getch (); Command nextCommand; switch (input) { case 'h': nextCommand.setAction (ACTION_MOVELEFT); break; case 'j': nextCommand.setAction (ACTION_MOVEDOWN); break; case 'k': nextCommand.setAction (ACTION_MOVEUP); break; case 'l': nextCommand.setAction (ACTION_MOVERIGHT); break; case 'y': nextCommand.setAction (ACTION_MOVEUPLEFT); break; case 'u': nextCommand.setAction (ACTION_MOVEUPRIGHT); break; case 'n': nextCommand.setAction (ACTION_MOVEDOWNLEFT); break; case 'm': nextCommand.setAction (ACTION_MOVEDOWNRIGHT); break; case '.': nextCommand.setAction (ACTION_WAIT); break; } return nextCommand; } and the error: Administrator@RHYS ~/code/rogue2 $ make g++ -c -Wall -pedantic -g3 -O0 input.cpp input.cpp: In member function `Command Input::next()': input.cpp:21: error: expected primary-expression before '=' token input.cpp:24: error: expected primary-expression before '=' token input.cpp:27: error: expected primary-expression before '=' token input.cpp:30: error: expected primary-expression before '=' token input.cpp:33: error: expected primary-expression before '=' token input.cpp:36: error: expected primary-expression before '=' token input.cpp:39: error: expected primary-expression before '=' token input.cpp:42: error: expected primary-expression before '=' token input.cpp:45: error: expected primary-expression before '=' token make: *** [input.o] Error 1 Sorry about the lack of linenumbers, the errors occur on the lines "nextCommand.setAction(...)", which is totally bizarre considering that they don't contain a '='. Any ideas? Thanks, Rhys

    Read the article

  • use php to parse json data posted from another php file

    - by akshay.is.gr8
    my web hosting has blocked the outward traffic so i am using a free web hosting to read data and post it to my server but the problem is that my php file receives data in the $_REQUEST variable but is not able to parse it. post.php function postCon($pCon){ //echo $pCon; $ch = curl_init('http://localhost/rss/recv.php'); curl_setopt ($ch, CURLOPT_POST, 1); curl_setopt ($ch, CURLOPT_POSTFIELDS, "data=$pCon"); curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1); $d=curl_exec ($ch); echo $d."<br />"; curl_close ($ch); } recv.php <?php if(!json_decode($_REQUEST['data'])) echo "json error"; echo "<pre>"; print_r($data); echo "</pre>"; ?> every time it gives json error. but echo $_REQUEST['data'] gives the correct json data. plz help.

    Read the article

  • Inserting an element within jQuery Validation plugin's error template

    - by simshaun
    I'm utilizing the jQuery Validation plugin for my form. It lets you change the errorElement and wrap the errorElement using with the wrapper option. But, I want to insert an element within errorElement like this: <label class="error"><em></em>Error message goes here</label> Is there an easy way to accomplish inserting the em tag? I've tried prepending the em tag using the errorPlacement option (see below), but it seems the plugin is replacing the contents of errorElement afterwards. $.validator.setDefaults({ errorPlacement: function(error, element) { error.prepend('<em/>'); error.insertBefore(element); } }); I've also tried prepending the em tag using the showErrors option (see below). Again, it seems the plugin is replacing the contents of errorElement afterwards. $.validator.setDefaults({ showErrors: function(errorMap, errorList) { for (var i = 0; i < errorList.length; i++) { var error = errorList[i], $label = this.errorsFor(error.element), $element = $(error.element); if ($label.length && $label.find('em').length == 0) { $label.prepend('<em/>'); } } this.defaultShowErrors(); } }); I've also tried modifying the plugin so that when the error element is generated, the <em> tag is prepended. That works until I focus on a form element that has an error, after which the em tag is removed. (It's doing this because jQuery validation is constantly updating the contents of the error element as I focus and/or type in the field, therefore erasing my em tag added at error-element creation.)

    Read the article

  • doesn't parse xml when it's a single node

    - by tag
    my script.php returns this XML <all> <item> <field1>value1</field1> <field2>value2</field2> </item> <item> <field1>value1</field1> <field2>value2</field2> </item> </all> The HTTPService uses the default resultFormat="object" but I don't declare it since it's the default. Then I bind it to a List dataProvider="{getDataHTTP.lastResult.all.item}" I get no problems when the number of item returned is more than 1. But when it's only 1 item I get an error cannot convert XMLList to mx.collections.IList. I tried different solutions including trying to cast it as XMLListCollection but it still gives an error for single items. Does anyone know of a way to possibly solve this?

    Read the article

  • help me to parse JSON value using JSONTouch

    - by EquinoX
    I have the following json: http://www.adityaherlambang.me/webservice.php?user=2&num=10&format=json I would like to get all the name in this data by the following code, but it gives an error. How can I fix it? NSString *responseString = [[NSString alloc] initWithData:responseData encoding:NSUTF8StringEncoding]; NSDictionary *results = [responseString JSONValue]; NSDictionary *users = [results objectForKey:@"users"] objectForKey:@"user"]; for (NSDictionary *user in users){ //NSLog(@"key:%@, value:%@", user, [user objectForKey:user]); NSString *title = [users objectForKey:@"NAME"]; NSLog(@"%@", title); } Error: 2011-01-29 00:18:50.386 NeighborMe[7763:207] -[__NSArrayM objectForKey:]: unrecognized selector sent to instance 0xb618840 2011-01-29 00:18:50.388 NeighborMe[7763:207] *** Terminating app due to uncaught exception 'NSInvalidArgumentException', reason: '-[__NSArrayM objectForKey:]: unrecognized selector sent to instance 0xb618840' *** Call stack at first throw: ( 0 CoreFoundation 0x027d9b99 __exceptionPreprocess + 185 1 libobjc.A.dylib 0x0292940e objc_exception_throw + 47 2 CoreFoundation 0x027db6ab -[NSObject(NSObject) doesNotRecognizeSelector:] + 187 3 CoreFoundation 0x0274b2b6 ___forwarding___ + 966 4 CoreFoundation 0x0274ae72 _CF_forwarding_prep_0 + 50 5 NeighborMe 0x0000bd75 -[NeighborListViewController connectionDidFinishLoading:] + 226 6 Foundation 0x0007cb96 -[NSURLConnection(NSURLConnectionReallyInternal) sendDidFinishLoading] + 108 7 Foundation 0x0007caef _NSURLConnectionDidFinishLoading + 133 8 CFNetwork 0x02d8d72f _ZN19URLConnectionClient23_clientDidFinishLoadingEPNS_26ClientConnectionEventQueueE + 285 9 CFNetwork 0x02e58fcf _ZN19URLConnectionClient26ClientConnectionEventQueue33processAllEventsAndConsumePayloadEP20XConnectionEventInfoI12XClientEvent18XClientEventParamsEl + 389 10 CFNetwork 0x02e5944b _ZN19URLConnectionClient26ClientConnectionEventQueue33processAllEventsAndConsumePayloadEP20XConnectionEventInfoI12XClientEvent18XClientEventParamsEl + 1537 11 CFNetwork 0x02d82968 _ZN19URLConnectionClient13processEventsEv + 100 12 CFNetwork 0x02d827e5 _ZN17MultiplexerSource7performEv + 251 13 CoreFoundation 0x027bafaf __CFRUNLOOP_IS_CALLING_OUT_TO_A_SOURCE0_PERFORM_FUNCTION__ + 15 14 CoreFoundation 0x0271939b __CFRunLoopDoSources0 + 571 15 CoreFoundation 0x02718896 __CFRunLoopRun + 470 16 CoreFoundation 0x02718350 CFRunLoopRunSpecific + 208 17 CoreFoundation 0x02718271 CFRunLoopRunInMode + 97 18 GraphicsServices 0x030b800c GSEventRunModal + 217 19 GraphicsServices 0x030b80d1 GSEventRun + 115 20 UIKit 0x002e9af2 UIApplicationMain + 1160 21 NeighborMe 0x00001c34 main + 102 22 NeighborMe 0x00001bc5 start + 53 23 ??? 0x00000001 0x0 + 1 ) terminate called after throwing an instance of 'NSException' I really just wanted to be able to iterate through the names

    Read the article

  • Windows Recovery from Grub messed up my computer?

    - by Hudson Worden
    Ok so I'm a noob when it comes to Operating Systems and I think I really messed up this time. So I have a laptop that dual boots Windows 7 and Linux Mint 11. I was trying to boot into Windows 7 but it would just have a black screen with a blinking cursor. So I turned off my computer and tried again. Still a black screen with a cursor. So I thought "well it must be broken somehow and I remembered seeing something like 'Windows Recovery' from the boot menu so I should try it." So when I turned on my computer a third time I selected 'Windows Recovery' (Something like that I can't remember exactly what it was called). After I had selected that I got a white Windows window that said in big red letters "ERROR". I turned off my computer again a turned it back on expecting the Grub menu to reappear. I was wrong. Instead I am greeted with error: no such partition grub rescue. Then I put in a live CD for ubuntu 11.04 and tried looking at my partitions using the disk manager. Looking at my partitions I notice that there isn't a Linux partition anymore and in its place is a unallocated space partition yet the Linux Swap partition is still there. My windows partition is still fine and I can access the files in it. If you understand what has happened, is there anyway I can get my files back? I don't care about reinstalling the OS again. I just want those files that are in the Linux Mint partition.

    Read the article

  • Resolving html entities with NSXMLParse on iPhone

    - by Roberto
    Hi all, i think i read every single web page relating to this problem but i still cannot find a solution to it, so here i am. I have an HTML web page wich is not under my control and i need to parse it from my iPhone application. Here it is a sample of the web page i'm talking about: <HTML> <HEAD> <META http-equiv="Content-Type" content="text/html; charset=ISO-8859-1"> </HEAD> <BODY> <LI class="bye bye" rel="hello 1"> <H5 class="onlytext"> <A name="morning_part">morning</A> </H5> <DIV class="mydiv"> <SPAN class="myclass">something about you</SPAN> <SPAN class="anotherclass"> <A href="http://www.google.it">Bye Bye &egrave; un saluto</A> </SPAN> </DIV> </LI> </BODY> </HTML> I'm using NSXMLParser and it is going well till it find the è html entity. It calls foundCharacters: for "Bye Bye" and then it calls resolveExternalEntityName:systemID:: with an entityName of "egrave". In this method i'm just returning the character "è" trasformed in an NSData, the foundCharacters is called again adding the string "è" to the previous one "Bye Bye " and then the parser raise the NSXMLParserUndeclaredEntityError error. I have no DTD and i cannot change the html file i'm parsing. Do you have any ideas on this problem? Thanks in advance to all of you, Rob. Update (12/03/2010). After the suggestion of Griffo i ended up with something like this: data = [self replaceHtmlEntities:data]; NSXMLParser *parser = [[NSXMLParser alloc] initWithData:data]; [parser setDelegate:self]; [parser parse]; where replaceHtmlEntities:(NSData *) is something like this: - (NSData *)replaceHtmlEntities:(NSData *)data { NSString *htmlCode = [[NSString alloc] initWithData:data encoding:NSISOLatin1StringEncoding]; NSMutableString *temp = [NSMutableString stringWithString:htmlCode]; [temp replaceOccurrencesOfString:@"&amp;" withString:@"&" options:NSLiteralSearch range:NSMakeRange(0, [temp length])]; [temp replaceOccurrencesOfString:@"&nbsp;" withString:@" " options:NSLiteralSearch range:NSMakeRange(0, [temp length])]; ... [temp replaceOccurrencesOfString:@"&Agrave;" withString:@"À" options:NSLiteralSearch range:NSMakeRange(0, [temp length])]; NSData *finalData = [temp dataUsingEncoding:NSISOLatin1StringEncoding]; return finalData; } But i am still looking the best way to solve this problem. I will try TouchXml in the next days but i still think that there should be a way to do this using NSXMLParser API, so if you know how, feel free to write it here :)

    Read the article

  • Failed upgrade of PHP on Ubunutu 12.04, error: Sub-process /usr/bin/dpkg returned an error code (1)

    - by DanielAttard
    I just tried to upgrade my version of PHP on Ubuntu 12.04 and now I have messed it up. First I did this: sudo add-apt-repository ppa:ondrej/php5-oldstable Then I did this: sudo apt-get update Then finally I did this: sudo apt-get install php5 And now I am getting an error message about Sub-process /usr/bin/dpkg returned an error code (1) What have I done wrong? How can I fix this problem? Thanks. Here are the errors received: Do you want to continue [Y/n]? Y debconf: DbDriver "config": /var/cache/debconf/config.dat is locked by another process: Resource temporarily unavailable Setting up libapache2-mod-php5 (5.4.28-1+deb.sury.org~precise+1) ... debconf: DbDriver "config": /var/cache/debconf/config.dat is locked by another process: Resource temporarily unavailable dpkg: error processing libapache2-mod-php5 (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already Setting up php5-cli (5.4.28-1+deb.sury.org~precise+1) ... debconf: DbDriver "config": /var/cache/debconf/config.dat is locked by another process: Resource temporarily unavailable dpkg: error processing php5-cli (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of php5-curl: php5-curl depends on phpapi-20100525+lfs; however: Package phpapi-20100525+lfs is not installed. Package libapache2-mod-php5 which provides phpapi-20100525+lfs is not configured yet. Package php5-cli which provides phpapi-20100525+lfs is not configured yet. dpkg: error processing php5-curl (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of php5-gd: php5-gd depends on phpapi-20100525+lfs; however: Package phpapi-20100525+lfs is not installed. Package libapache2-mod-php5 which provides phpapi-20100525+lfs is not configured yet. Package php5-cli which provides phpapi-20100525+lfs is not configured yet. dpkg: error processing php5-gd (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of php5-mcrypt: php5-mcrypt depends on phpapi-20100525+lfs; however: Package phpapi-20100525+lfs is not installed. Package libapache2-mod-php5 which provides phpapi-20100525+lfs is not configured yet. Package php5-cli which provides phpapi-20100525+lfs is not configured yet. dpkg: error processing php5-mcrypt (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of php5-mysql: php5-mysql depends on phpapi-20100525+lfs; however: Package phpapi-20100525+lfs is not installed. Package libapache2-mod-php5 which provides phpapi-20100525+lfs is not configured yet. Package php5-cli which provides phpapi-20100525+lfs is not configured yet. dpkg: error processing php5-mysql (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of php5: php5 depends on libapache2-mod-php5 (>= 5.4.28-1+deb.sury.org~precise+1) | libapache2-mod-php5filter (>= 5.4.28-1+deb.sury.org~precise+1) | php5-cgi (>= 5.4.28-1+deb.sury.org~precise+1) | php5-fpm (>= 5.4.28-1+deb.sury.org~precise+1); however: Package libapache2-mod-php5 is not configured yet. Package libapache2-mod-php5filter is not installed. Package php5-cgi is not installed. Package php5-fpm is not installed. dpkg: error processing php5 (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: libapache2-mod-php5 php5-cli php5-curl php5-gd php5-mcrypt php5-mysql php5 E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • Php code not executing - dies out when trying to create an object of class - no error displayed

    - by Ali
    I'm having some problems with this piece of code. I've included a class declaration and trying to create an object of that class but my code dies out. It doesn't seem to be an include issue as all the files are being included even the files called for inclusion within the class file itself. However the object is not created - I tried to put an echo statement in the __construct function but nothing it just doesn't run infact doesn't create the object and the code won't continue from there - plus no error is reported or displayed and I have error reporting set to E_ALL and display errors set to true WHats happening here :(

    Read the article

  • Uploading image file from website on yahoo server causes 410 gone error message when trying to acces

    - by creocare
    I have a form that lets users upload a photo of themselves. This seems to work. The photo does exist on the server once uploaded. When I try to access the file I get a "403 forbidden - you don't have permission to access this url on this sever" and also I get "Additionally, a 410 Gone error was encountered while trying to use an ErrorDocument to handle the request." This is the code I have for uploading the image. $target_path = "images/"; $target_path = $target_path . basename( $_FILES['uploadpic']['name']); if(move_uploaded_file($_FILES['uploadpic']['tmp_name'], $target_path)) { echo "The file ". basename( $_FILES['uploadpic']['name']). " has been uploaded"; } else { echo "There was an error uploading the file, please try again!"; }

    Read the article

  • What is Error 324? Is it related to Google Chrome? Or Verizon Webmail?

    - by Jason Rhodes
    My in-laws are having trouble with signing into their Verizon Webmail account at webmail.verizon.net, only when they are on their wireless network. When they try to log in from wireless they get "Error 324" in the browser, in both Google Chrome AND IE8. But they can access any other site, and they can get on their Verizon email when they plug in directly to the browser. Does anyone know why this is?

    Read the article

  • Python: saving objects and using pickle. Error using pickle.dump

    - by Peterstone
    Hello I have an Error and I don´t the reason: >>> class Fruits:pass ... >>> banana = Fruits() >>> banana.color = 'yellow' >>> banana.value = 30 >>> import pickle >>> filehandler = open("Fruits.obj",'w') >>> pickle.dump(banana,filehandler) Traceback (most recent call last): File "<stdin>", line 1, in <module> File "C:\Python31\lib\pickle.py", line 1354, in dump Pickler(file, protocol, fix_imports=fix_imports).dump(obj) TypeError: must be str, not bytes >>> I don´t know how to solve this error because I don´t understand it. Thank you so much.

    Read the article

  • Best practices retrieving XML/stream from HTTP in Android

    - by Jeffrey
    Hello everyone, what are the best practices parsing XML from an HTTP resource in Android? I've been using HttpURLConnection to retrieve an InputStream, wrapping it with a BufferedInputStream, and then using SAX to parse the buffered stream. For the most part it works, though I do receive error reports of SocketTimeoutException: The operation timed out or general parsing error. I believe it's due to the InputStream. Would using HttpClient instead of HttpURLConnection help? If yes, why? Should the stream be output to a file, having the file parsed instead of the stream? Any input or direction would be greatly appreciated. Thanks for your time.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHP Error, is it resolvable, or a language bug?

    - by rls
    Given the following code $c= new SoapClient('http://www.webservicex.net/CurrencyConvertor.asmx?WSDL'); $usa = "USD"; $eng = "GBP"; doing a __getTypes on the client gives me Array ( [0] => struct ConversionRate { Currency FromCurrency; Currency ToCurrency; } [1] => string Currency [2] => struct ConversionRateResponse { double ConversionRateResult; } ) if i then do $calculation = $c->ConversionRate($usa, $eng); and print calculation i get an error about Catchable fatal error: Object of class stdClass could not be converted to string Is there a specific way i should be printing this out, or i it a bug, from researching / googling many people seem to have a problem but i cant find a suitbale solution, other than downgrading php, which isnt a solution for me as i am doing this as homework and its running off of a college server

    Read the article

  • IIS6 + PHP + FastCGI 500 Errors - Where do I start looking?

    - by Bertvan
    I've set up IIS6 with FastCGI to use php-cgi.exe. I have some php websites by external parties, that I'm trying to run in a test environment. One of the websites just plain gives me a FastCGI Error Page. Is there some way to enable logging somewhere so that I can get a bit more information on this problem? I have looked in - Eventlog - IIS Website log (c:\windows\system32\Logfiles) - PHP log But no results, except the IIS Website log mentions a return of a 500 page. Is there any other way to debug/check where things might be going wrong? Here is what the page looks like: FastCGI Error The FastCGI Handler was unable to process the request. Error Details: The FastCGI process exited unexpectedly Error Number: -1073741571 (0xc00000fd). Error Description: Unknown Error HTTP Error 500 - Server Error. Internet Information Services (IIS)

    Read the article

  • Deleting a database row with mysql - getting an error!?

    - by Nike
    Here's the code: mysql_query("DELETE " . $_GET['id'] . " FROM forum_favorites WHERE thread_id='" . $_GET['id'] . "' AND user='" . $userinfo['username'] . "'") or die(mysql_error()); And the error message: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near '77 FROM forum_favorites WHERE thread_id='77' AND user='nike1'' at line 1 Anyone knows what's up here? I've been stuck here for hours now and i just can't figure out what the heck's wrong? The database name and the column names are correct. Thanks. -Nike

    Read the article

  • jQuery ajax is throwing an error code 302... what is this?

    - by AndreMiranda
    Hi everyone! I'm working with ASP.NET MVC and jQuery and I have a UserControl that is repeated in every page. And in every page request, a ajax callback occurs... so far so good. But this is when I'm in localhost. When I publish the site, I notice that this ajax is throwing an error 302, but this only occus in HTTPS pages and in FF and Chrome... on IE this ajax request works fine. What is this error 302? Why it only occurs on https pages and only in FF or chrome? thank you all!!

    Read the article

< Previous Page | 78 79 80 81 82 83 84 85 86 87 88 89  | Next Page >