Search Results

Search found 68249 results on 2730 pages for 'sudo work'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 948/2730 | < Previous Page | 944 945 946 947 948 949 950 951 952 953 954 955  | Next Page >

  • How to fix winlogon.exe randomly crashing/hanging my computer?

    - by Neeb
    I've got these problems: 1) sometimes winlogon.exe crashes at boot-up and my whole computer shuts off once i click "no" to visual-studio-2008 just-in-time-debugger window, takes about 30 secs until my harddrives starts up again, its really scary, i am afraid it is causing hardware malfunctions in long term. this has happened dozen of time now. 2) sometimes i leave the computer alone a while, i come back and i notice ctrl+alt+del doesnt work and winlogon.exe is using 100% of one of my 4 cores.

    Read the article

  • Cannot enable wireless Ubuntu 10.04

    - by woaddoa
    I have recently installed Ubuntu 10.04, however I am having trouble getting wireless to work. Ubuntu says that wireless is disabled, and I am unable to enable it. I have tried Administration Hardware Drivers however the only drivers listed are Nivida graphics ones. I am unsure what to do as I do not think the process is the same as searching for drivers for a windows machine. Any advice appreciated.

    Read the article

  • Merge executables to avoid multiple UAC

    - by petebob796
    Is there a program that can merge multiple windows executables into one that can run concurrently or in a sequence. I realize this sounds like how virus's often work but I have real needs. I am trying to avoid multiple UAC prompts in an installation process that runs up multiple MS hot fixes. Any other advice on ways to avoid the UAC prompts when multple exe's are to be installed is appreciated.

    Read the article

  • Install windows xp using USB: removable disk option not available in boot device options list

    - by kowsar89
    I want to install windows xp with pendrive as my dvdrom doesnt work. When i go to bios setup and boot device options,i cant find any option for pendrive.Here's my boot device options: >1st FLOPPY DRIVE >3M-HDS728080PLA >PS-ASUS DVD-E818A >DISABLED And Here's my desktop configuration: intel(R) pentium(R) 4 CPU 2.66GHz 0.99GB RAM N.B: I bought my desktop in 2006. Now how can i install windows xp in my desktop using pendrive?

    Read the article

  • How to do something like `mplayer movie.mpg` from ssh and it play on the current display?

    - by Earlz
    I've set up a little media center computer running Arch Linux. I want to eventually get it so that there is no keyboard or mouse required. Right now I want the solution to be SSH. My problem is that when I do something like mplayer movie.mpg over an ssh shell, I'll just get vo: couldn't open the X11 display ()! How do I get this to work correctly and play on my TV(the display the media center computer is hooked to)?

    Read the article

  • Setting up multiple highlight rules in vim

    - by ICR
    I am trying to set up rules to highlight both trailing whitespace and lines which are over a certain length by adding this to my .vimrc: highlight ExtraWhitespace ctermbg=lightgray guibg=lightgray match ExtraWhitespace /\s\+$/ highlight OverLength ctermbg=lightgray guibg=lightgray match OverLength /\%>80v.\+/ However, it only seems to pick up whichever is last. I can't find a way to get them to both work simultaneously.

    Read the article

  • hardlinks on ntfs with windows

    - by knittl
    is it possible to create hardlinks for a file on an ntfs partition using windows? ntfs obviously can handle hardlinks, since creating them with ntfs-3g works – the links even work in windows. or is this the only way to create hardlinks on ntfs?

    Read the article

  • Remotely Administer Workgroup Computers

    - by Steven
    At work, I can remotely administer other computers by first adding my domain account as a local admistrator on another computer. After that, I can use remote registry, computer management, and file sharing (\\computer\c$). How can I setup a remote user to be a local administrator on a simple home network without a domain (just a workgroup)?

    Read the article

  • Multiple pages per sheet (PDF)

    - by smihael
    I use the following commands pdf2ps input.pdf - | psnup -pA4 -4 >> output.ps ps2pdf output.ps output.pdf rm output.ps to merge multiple pages (in this case 4) from input file to one sheet in outupt file. How can I modify pipelining so that I won't have to use 2 commands, but just a single one liner? Is there any other commandline tool that would do the same and can work directly on pdf files?

    Read the article

  • 403 Forbidden for web root on Apache on Mac OS X v10.7, but can access user directories

    - by philosophistry
    When I access http://localhost/ I get 403 Forbidden, but if I access http://localhost/~username it serves up pages. Things I've tried: Checking error logs Swapping out with original httpd conf files Changing DocumentRoot to my user directory (after all that should work if I can access ~username) I've seen 30 plus Q&A sites that all point to people having trouble with user directories being forbidden. I have the opposite problem, and so I'm tearing my hair out here.

    Read the article

  • Forms authentication for main site, Windows auth for subfolder

    - by John D
    Hi all, On my Windows 2008 R2 server with IIS 7.5 I would like to have my ASP.NET website running with forms authentication, while protecting a subfolder with the basic Windows authentication. I have done this on Windows 2003 with IIS 6 for years, but I simply can't get it to work with IIS 7.5. Your input would be highly appreciated :)

    Read the article

  • Do newer physical interfaces make a better linux firewall?

    - by pfyon
    At work we use an old (10 year old) linux box with 4 interfaces to act as router/firewall for the network. There's never really been a need to change it since it's stable and handles all our needs. I'm wondering, though, would replacing the network interfaces with newer ones provide a benefit? Besides the obvious bandwidth increase (eg. 100MBit to GBit), would there be a latency reduction, or do newer cards pretty much do the same thing as old ones?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Cannot write DVDs anymore (can still read them and write CDs) STUMPED

    - by YAS
    I'm stumped. I used to be able to write to DVDs and now I can't. I've tried different media (Memorex and Imations) I've tried different drives (internal and external) and even different OS's (Windows 7 and Linux Mint). Nothing I've done will work and it's a real problem not being able to burn DVD's. I'm on an Acer 6930 if that helps. Does anyone have any ideas?

    Read the article

  • Is my external hard drive dying?

    - by thatotherguy
    I keep getting this error lately when I try to copy large (200+ MB) files over to my external. Following this, the disk becomes unresponsive and I got to unplug it and plug it in again to work. The copy process also is unreasonably slow. It is worth noting that this happens on Windows too, so it's not the notorious "Error -36" bug OS X had prior to 10.6.3. The disk is a Western Digital 3200BMV. Any ideas?

    Read the article

  • Postgres + OpenStreeMap Amazon snapshot

    - by user32425
    Hi, I am trying to start my postgres using /etc/init.d/postgresql-8.3 start but I got this * Starting PostgreSQL 8.3 database server * Error: The server must be started under the locale : which does not exist any more. ...fail! I tried the solution in http://ubuntuforums.org/archive/index.php/t-397005.html but it still does not work. How can I fix this? Thanks

    Read the article

  • How do I use a period in a Quicksilver object (search for a file with a period)?

    - by studgeek
    How do I use a period in a Quicksilver object to do things like search for a file with a period? By default pressing period anywhere in an object causes Quicksilver to switch to text mode. Optimally I would like period to only enter text mode when its at the start of the object. Or perhaps there is a wildcard I can use (* doesn't seem to work and . obviously doesn't :). Or perhaps there is an escape sequence for period?

    Read the article

  • Java application delivery through CDN

    - by tuler
    We have a java application bundled as an applet or as webstart. The client java plugin caches the jar files on the client machine and downloads a new version if there is one. Is it possible to deliver this jar files using a CDN? What are the issues involved? Which CDNs would work for jar delivery? Is this different from static content delivery like images or video?

    Read the article

  • Smooth scrolling in Emacs/Windows

    - by Svend
    As the subject title says, has anyone any suggestions for how to achieve smooth scrolling of the text display in emacs? The various approaches suggested on the Emacs wiki seem to work only in Linux. I'm using EmacsW32 for what it matters, but I tested with the standard Emacs distribution as well, with no results. As a long time Vim user, I'm fairly surprised that Emacs cannot scroll smoothly by itself.

    Read the article

  • Batch file installing executable only gives SYSTEM permissions

    - by Alex
    So, I have a couple of batch files that install some executables and they work, but when the executables setup shortcuts on the desktop only SYSTEM has access to them. Is there a way I can prevent that or make it so it adds Domain Users access or something like that. I realize that the batch files are ran under the SYSTEM context, but I'd like to find a way to clean up after them. Thanks in advance!

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 944 945 946 947 948 949 950 951 952 953 954 955  | Next Page >