Search Results

Search found 10698 results on 428 pages for 'inline functions'.

Page 99/428 | < Previous Page | 95 96 97 98 99 100 101 102 103 104 105 106  | Next Page >

  • C++ template partial specialization error

    - by JP19
    Hi, The following code is giving me a compilation error: class Q64 is not a valid type for a template constant parameter template<int GRIDD, class T> INLINE T grid_residue(T amount) { T rem = amount%(GRIDD); if (rem > GRIDD/2) rem -= GRIDD; return rem; } template<int GRIDD, Q64> INLINE Q64 grid_residue(Q64 amount) { return Q64(grid_residue<GRIDD, int64_t>(to_int(amount))); } Whats wrong? I am trying to specialize grid_residue for class Q64. thanks

    Read the article

  • Static code analysis for VB6 and classic ASP

    - by Ryan
    I'm looking for a static code analysis tool that will determine if I have orphaned functions in my VB6 code. The problem I'm running into is we make calls to the VB6 code from classic asp. Is there a tool that will look at both the classic asp and VB6 and determine if there are any orphaned functions?

    Read the article

  • SqlMetal, Sql Server 2008 database, Table with HierachyID, dal cs file is created sometimes ?

    - by judek.mp
    I have 2 databases with a 2 tables with HierachyID fields. For one database I can get a dal cs file, for the other database I cannot get a dal cs file ? HBus is a database I can get the dal cs for, ... SqlMetal /server:.\SQLSERVER2008 /database:HBus /code:HBusDC.cs /views /functions /sprocs /namespace:HBusDC /context:HBusDataContext This kicks me out a file, ... which works, but excludes the HierarchyID field for the table and includes all other fields for that table. This is OK I do not mind. The above cmd line kicks out an warning but still produces a file, like so SqlMetal /server:.\SQLSERVER2008 /database:HBus /code:HBusDC.cs /views /functions /sprocs /namespace:HBusDC /context:HBusDataContext Microsoft (R) Database Mapping Generator 2008 version 1.00.30729 for Microsoft (R) .NET Framework version 3.5 Copyright (C) Microsoft Corporation. All rights reserved. Warning : SQM1021: Unable to extract column 'OrgNode' of Table 'dbo.HMsg' from SqlServer because the column's DbType is a user-defined type (UDT). Warning : SQM1021: Unable to extract column 'OrgNode' of Table 'dbo.vwHMsg' from SqlServer because the column's DbType is a user-defined type (UDT). HMsg is a table with a HierarchyID field. I have another database, Elf, almost the same thing but I get a warning and an Error when using sql metal and I do not get a dal cs file ... SqlMetal /server:.\SQLSERVER2008 /database:Elf /code:ElfDataContextDal.cs /views /functions /sprocs /namespace:HBusDC /context:HBusDataContext An error as well as the warning and the cs file fails to appear on my disc, ... :-( SqlMetal /server:.\SQLSERVER2008 /database:Elf /code:ElfDataContextDal.cs /views /functions /sprocs /namespace:HBusDC /context:HBusDataContext Microsoft (R) Database Mapping Generator 2008 version 1.00.30729 for Microsoft (R) .NET Framework version 3.5 Copyright (C) Microsoft Corporation. All rights reserved. Warning : SQM1021: Unable to extract column 'OrgNode' of Table 'dbo.EntityLink' from SqlServer because the column's DbType is a user-defined type (UDT). Error : Requested value 'ELF.SYS.HIERARCHYID' was not found. The fields are declared the same way in Elf db OrgNode [HierarchyID] null , in HBus db ... OrgNode [HierarchyID] null , Both databases are in the same instance of sql server 2008, so the HierarchyID is an inbuilt type, neither db has HierarchyID udt ,... cheers in advance for any replies ...

    Read the article

  • Can't update textbox in TinyMCE

    - by Michael Tot Korsgaard
    I'm using TinyMCE, the text area is replaced with a TextBox, but when I try to update the database with the new text from my textbox, it wont update. Can anyone help me? My code looks like this <%@ Page Title="" Language="C#" MasterPageFile="~/Main.Master" AutoEventWireup="true" CodeBehind="default.aspx.cs" Inherits="Test_TinyMCE._default" ValidateRequest="false" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" runat="server"> <script src="JavaScript/tiny_mce/tiny_mce.js" type="text/javascript"></script> <script type="text/javascript"> tinyMCE.init({ // General options mode: "textareas", theme: "advanced", plugins: "pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,insertdatetime,pre view,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,no nbreaking,xhtmlxtras,template,wordcount,advlist,autosave", // Theme options theme_advanced_buttons1: "save,newdocument,|,bold,italic,underline,strikethrough,|,justifyleft,justifycenter,justifyright,justifyfull,styleselect,formatselect,fontselect,fontsizeselect", theme_advanced_buttons2: "cut,copy,paste,pastetext,pasteword,|,search,replace,|,bullist,numlist,|,outdent,indent,blockquote,|,undo,redo,|,link,unlink,anchor,image,cleanup,help,code,|,insertdate,inserttime,preview,|,forecolor,backcolor", theme_advanced_buttons3: "tablecontrols,|,hr,removeformat,visualaid,|,sub,sup,|,charmap,emotions,iespell,media,advhr,|,print,|,ltr,rtl,|,fullscreen", theme_advanced_buttons4: "insertlayer,moveforward,movebackward,absolute,|,styleprops,|,cite,abbr,acronym,del,ins,attribs,|,visualchars,nonbreaking,template,pagebreak,restoredraft", theme_advanced_toolbar_location: "top", theme_advanced_toolbar_align: "left", theme_advanced_statusbar_location: "bottom", theme_advanced_resizing: true, // Example content CSS (should be your site CSS) // using false to ensure that the default browser settings are used for best Accessibility // ACCESSIBILITY SETTINGS content_css: false, // Use browser preferred colors for dialogs. browser_preferred_colors: true, detect_highcontrast: true, // Drop lists for link/image/media/template dialogs template_external_list_url: "lists/template_list.js", external_link_list_url: "lists/link_list.js", external_image_list_url: "lists/image_list.js", media_external_list_url: "lists/media_list.js", // Style formats style_formats: [ { title: 'Bold text', inline: 'b' }, { title: 'Red text', inline: 'span', styles: { color: '#ff0000'} }, { title: 'Red header', block: 'h1', styles: { color: '#ff0000'} }, { title: 'Example 1', inline: 'span', classes: 'example1' }, { title: 'Example 2', inline: 'span', classes: 'example2' }, { title: 'Table styles' }, { title: 'Table row 1', selector: 'tr', classes: 'tablerow1' } ], // Replace values for the template plugin template_replace_values: { username: "Some User", staffid: "991234" } }); </script> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" runat="server"> <div> <asp:TextBox ID="TextBox1" runat="server" TextMode="MultiLine"></asp:TextBox> <br /> <asp:LinkButton ID="LinkButton1" runat="server" onclick="LinkButton1_Click">Update</asp:LinkButton> </div> </asp:Content> My codebhind looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Web.UI.WebControls; namespace Test_TinyMCE { public partial class _default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { TextBox1.Text = Database.GetFirst().Text; } protected void LinkButton1_Click(object sender, EventArgs e) { Database.Update(Database.GetFirst().ID, TextBox1.Text); TextBox1.Text = Database.GetFirst().Text; } } } And finally the "Database" class im using looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Configuration; using System.Data.SqlClient; namespace Test_TinyMCE { public class Database { public int ID { get; set; } public string Text { get; set; } public static void Update(int ID, string Text) { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Update Text set Text=@text where ID=@id"); command.Connection = connection; command.Parameters.Add(new SqlParameter("id", ID)); command.Parameters.Add(new SqlParameter("text", Text)); command.ExecuteNonQuery(); } finally { connection.Close(); } } public static Database GetFirst() { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Select Top 1 ID, Text from Text order by ID asc"); command.Connection = connection; SqlDataReader reader = command.ExecuteReader(); if (reader.Read()) { Database item = new Database(); item.ID = reader.GetInt32(0); item.Text = reader.GetString(1); return item; } else { return null; } } finally { connection.Close(); } } } } I really hope that someone out there can help me

    Read the article

  • How to put a breakpoint at the end of a function in windbg, so that I dont need to edit it even if s

    - by shan23
    I need to log some data when some functions are hit, both at the start of execution and and the end of it. While i have no problem with putting breakpoints at the start of the functions(using bu [module]!functionname, I dont know how to put a breakpoint at the end of a function, SUCH THAT i dont need to edit the breakpoint everytime i add/delete somelines from the file/function. I'm sure its a very common scenario, just that I dont know how its done !! Can anyone elucidate ?

    Read the article

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • using moogaloop to embed a custom video player from Vimeo

    - by scullytr
    Anyone have any luck using Vimeo's moogaloop player? I'm wanting to use Vimeo's supposed API functions to create custom buttons to control the Vimeo player on my site. Here's the reference page for moogaloop: http://vimeo.com/api/docs/moogaloop I've been able to get the player to embed using SWFObject, but I can't seem to get the API functions to work (e.g. api_play()). Any help is greatly appreciated. Thanks! -Tim.

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • .NET: Writing DataAccess dll

    - by RedsDevils
    I would like to write all data relations processes (general functions regarding with DataAccess via .NET) in dll and I want to use it repeatedly. What kinds of functions should have in that dll? Some want to use Stored Procedures , Some with Statements. Can you all suggest me? Please guide me! Thanks all!

    Read the article

  • Is there a free web file manager like Plesk or cPanel in ASP.Net

    - by Ron Klein
    I'm looking for a free, open-sourced web application written in C#/VB.Net on top of ASP.Net, which functions like Plesk or cPanel when it comes to (remote) file management. Something that simulates a regular FTP client, but actually displays web pages over HTTP, with the following functions: Create Folder Rename File/Folder Delete File/Folder Change Timestamp ("Touch") Move Archive etc. I saw a few commercial tools, but nothing when it comes to OSS. Any ideas? links?

    Read the article

  • .NET: Wrinting DataAccess dll

    - by RedsDevils
    I would like to write all data relations processes (general functions regarding with DataAccess via .NET) in dll and I wanna use it repeatedly. What kinds of functions should have in that dll? Some want to use Storedprocedures , Some with Statemets. Can you all suggest me? Please guide me! Thanks all!

    Read the article

  • Ignore SSL errors in Zend_Http_Client

    - by webdestroya
    In PHP curl there are two functions used to ignore all SSL errors (invalid cert, self signed, expired, so on): curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, false); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, false); I am switching over to use Zend_Http_Client, but I can't seem to find a way to force it to ignore errors. (I don't have a way to test it just yet, I wanted to see if anybody has done this before) So, does anybody know the equivalent function/functions to do this in Zend_Http_Client?

    Read the article

  • Calling javascript class within other Js

    - by harigm
    I have Aptana plugin in eclipse, I have a javascript (one.js) and i have included one more Javscript(two.js) within one.js. I click on any functions within one.js and if those functions exists in the same one.js, the control is going to the respective function. Suppose if the function exists in two.js, the control is not going to two.js Can any one help me with this?

    Read the article

  • Which keycode for escape key with jQuery

    - by Shishant
    I have two functions. When enter is pressed the functions runs correctly but when escape is pressed it doesn't. What's the correct number for the escape key? $(document).keypress(function(e) { if (e.which == 13) { $('.save').click(); } // enter (works as expected) if (e.which == 27) { $('.cancel').click(); } // esc (does not work) });

    Read the article

  • Uploading images from server using Php

    - by THOmas
    In my php application i have a folder in which all the photos are kept. The images are in different sizes.So i want to select photos from the folder and applying some image functions and upload to a different folder through php code. This is same as image uploading but the difference is that the source file is in server That is i want to select photos from server applying some image functions and upload again on the server Pls help me

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • F# Tacit Programming. Please help)

    - by Bubba88
    It's not a practically important issue, but could you please provide me with an example of tacit programming in F# where my `pointless' functions can have multiple arguments (not in form of list or tuple); And secondly, where those functions can manipulate a complex data structure. I'm trying to manage it in FSharp interactive, but have no success yet. Huh.. I've managed to construct something: (fun _ - (fun _ - (+))) 333 222 111 555 Is that right way?

    Read the article

  • AS3/Flex Override function in imported swf

    - by Riccardo
    I'm using a flex component that use a to load a .swf file. The loaded .swf - is passed to me as is and I can't edit - it has some as3 functions in it Is it possible in the "parent" application (the one with ) to override functions included in the "child" swf (the imported one)? And if it's possible, how? Thanks

    Read the article

  • Arduino (processing) Library in Netbeans and control

    - by Casper Marcussen
    Hello everyone I am trying to control 4 LEDs and getting analog input from 4 contacts. The program is written in java, so to gain acces to the functions of arduino, such as AnalogRead() and setting an LED to high or low, would importing the processing library let the program use those functions? I was also wondering, if the program, will be transferred to the arduino it self, or the java program will just pull the data from the pins?

    Read the article

  • Avoiding stack overflows in wrapper DLLs

    - by peachykeen
    I have a program to which I'm adding fullscreen post-processing effects. I do not have the source for the program (it's proprietary, although a developer did send me a copy of the debug symbols, .map format). I have the code for the effects written and working, no problems. My issue now is linking the two. I've tried two methods so far: Use Detours to modify the original program's import table. This works great and is guaranteed to be stable, but the user's I've talked to aren't comfortable with it, it requires installation (beyond extracting an archive), and there's some question if patching the program with Detours is valid under the terms of the EULA. So, that option is out. The other option is the traditional DLL-replacement. I've wrapped OpenGL (opengl32.dll), and I need the program to load my DLL instead of the system copy (just drop it in the program folder with the right name, that's easy). I then need my DLL to load the Cg framework and runtime (which relies on OpenGL) and a few other things. When Cg loads, it calls some of my functions, which call Cg functions, and I tend to get stack overflows and infinite loops. I need to be able to either include the Cg DLLs in a subdirectory and still use their functions (not sure if it's possible to have my DLLs import table point to a DLL in a subdirectory) or I need to dynamically link them (which I'd rather not do, just to simplify the build process), something to force them to refer to the system's file (not my custom replacement). The entire chain is: Program loads DLL A (named opengl32.dll). DLL A loads Cg.dll and dynamically links (GetProcAddress) to sysdir/opengl32.dll. I now need Cg.dll to also refer to sysdir/opengl32.dll, not DLL A. How would this be done? Edit: How would this be done easily without using GetProcAddress? If nothing else works, I'm willing to fall back to that, but I'd rather not if at all possible. Edit2: I just stumbled across the function SetDllDirectory in the MSDN docs (on a totally unrelated search). At first glance, that looks like what I need. Is that right, or am I misjudging? (off to test it now) Edit3: I've solved this problem by doing thing a bit differently. Instead of dropping an OpenGL32.dll, I've renamed my DLL to DInput.dll. Not only does it have the advantage of having to export one function instead of well over 120 (for the program, Cg, and GLEW), I don't have to worry about functions running back in (I can link to OpenGL as usual). To get into the calls I need to intercept, I'm using Detours. All in all, it works much better. This question, though, is still an interesting problem (and hopefully will be useful for anyone else trying to do crazy things in the future). Both the answers are good, so I'm not sure yet which to pick...

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 95 96 97 98 99 100 101 102 103 104 105 106  | Next Page >