Search Results

Search found 3861 results on 155 pages for 'evented io'.

Page 101/155 | < Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • how to feed a file to telnet

    - by knittl
    hello community, understanding http and headers i played around with telnet to send requests. to not type everything again and again and again i thought i'd write a small textfile with all the commands i need. my file is as simple as follows: GET /somefile.php HTTP/1.1 Host: localhost i then try to feed it to telnet with io-redirection: $ telnet localhost 80 < telnet.txt but all output i get is Trying ::1... Connected to localhost. Escape character is '^]'. Connection closed by foreign host. what am i doing wrong?

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • java checked exception in a catch clause compilation error

    - by srandpersonia
    Hi, I was expecting an compilation error in the following program because of the throw statement in the catch block as IOException is a checked exception and it is not caught by another try block within the catch block. But I am getting "Hurray!" printed. Any explanation would be much appreciated. According to JLS 11.2.3, http://java.sun.com/docs/books/jls/third_edition/html/exceptions.html It is a compile-time error if a method or constructor body can throw some exception type E when both of the following hold: * E is a checked exception type * E is not a subtype of some type declared in the throws clause of the method or constructor. import java.io.*; public class Test{ public static void main(String args[]) { System.out.println(method()); } public static int method() { try{ throw new Exception(); } catch(Exception e){ throw new IOException(); //No compile time error } finally{ System.out.println("Hurray!"); } } } Thanks in advance.

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • [ASP.NET] IIS7 downloading file length

    - by GTD
    I've following code for file download: FileInfo fileInfo = new FileInfo(filePath); context.Response.Clear(); context.Response.ContentType = "application/octet-stream"; context.Response.AddHeader("Content-Disposition", "attachment; filename=" + System.IO.Path.GetFileName(filePath)); context.Response.AddHeader("Content-Length", fileInfo.Length.ToString()); context.Response.WriteFile(filePath); context.Response.End(); When I run it on my local IIS6 it works fine. Web browser (tested on IE8, Firefox 3.5.2, Opera 10) shows file length before I start download the file. When I run this code on remote IIS7, web browser doesn't shows file length. File length is unknown. Why I don't get file length when this code runs under IIS7?

    Read the article

  • MS Build Server 2010 - Buffer Overflow

    - by user329005
    Hey everybody, I try to build an solution in MS Build Server (MS Visual Studio 2010 ver 10.0.30319.1) about ServerTasks - Builds - Server Task Builder - Queue new Built and go, 47 seconds later I get an error output: CSC: Unexpected error creating debug information file 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.PDB' -- 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.pdb: Access denied I checked the permissions of directory and set it (for debug purposes only) to grant access for all users, but still having an issue. Running the Procmon and filter file access for directory: 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\' tells me: 16:41:00,5449813 TFSBuildServiceHost.exe 3528 QuerySecurityFile C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug BUFFER OVERFLOW Information: DACL, 0x20000000 and 16:41:00,5462119 TFSBuildServiceHost.exe 3528 QueryOpen C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug FAST IO DISALLOWED Any ideas?

    Read the article

  • "Ant all" not working for me

    - by bobjink
    I have got involved in a project. This project uses ant which is not something I am comfortable with. I have checked out the source code and tried running ant on the most outer directory. Running 'ant' in commando prompt takes 1 sec and I get a BUILD SUCCESFULL message. If I run 'ant all' I get a BUILD FAILED. Java.io.IOExceptio: Cannot run program "ant": CreateProcess=2, the system cannot find the file specified and then a long stacktrace. Most of the people on the project runs OS-X while I use Windows XP. Any help or information is appreciated :)

    Read the article

  • Why doesn't this code using the ruby-mbox gem parse mbox files?

    - by cartoonfox
    I installed ruby-mbox by doing gem install ruby-mbox Running this: #!/usr/bin/ruby require 'rubygems' require 'mbox' m = IO.read('test.eml') puts m.size m = Mbox.new(m) puts m produces this: 71309505 /Library/Ruby/Gems/1.8/gems/ruby-mbox-0.0.2/lib/mbox/mbox.rb:45:in `initialize': uninitialized constant Mbox::StringIO (NameError) from r.rb:7:in `new' from r.rb:7 I have proved that "m" is assigned a string containing the contents of the file, just before Mbox.new(m) is called. It looks as though the Mbox::StringIO should have been defined by hasn't been. What's going wrong here? Ruby version: ruby 1.8.7 (2009-06-12 patchlevel 174) [universal-darwin10.0] (That's the default ruby installed on OS X 10.6.6)

    Read the article

  • how do I get the IP of incoming ICMP due to UDP-send to dead client in Ruby?

    - by banister
    so.. I'm doing a small multiplayer game with blocking UDP and IO.select. To my problem.. (In the server) reading from a UDP socket (packet, sender = @socket.recvfrom(1000)) which have just sent a packet to a dead client results in a ICMP unreachable (and exception Errno::ECONNRESET in ruby). The problem is that I can't find any way whatsoever to extract the IP of that ICMP.. so I can clean out that dead client. Anyone know how to achieve this? thanks

    Read the article

  • Why is lua crashing after extracting zip files?

    - by Brian T Hannan
    I have the following code but it crashes every time it reaches the end of the function, but it successfully extracts all the files and puts them in the right location. require "zip" function ExtractZipAndCopyFiles(zipPath, zipFilename, destinationPath) local zfile, err = zip.open(zipPath .. zipFilename) -- iterate through each file insize the zip file for file in zfile:files() do local currFile, err = zfile:open(file.filename) local currFileContents = currFile:read("*a") -- read entire contents of current file local hBinaryOutput = io.open(destinationPath .. file.filename, "wb") -- write current file inside zip to a file outside zip if(hBinaryOutput)then hBinaryOutput:write(currFileContents) hBinaryOutput:close() end end zfile:close() end -- call the function ExtractZipAndCopyFiles("C:\\Users\\bhannan\\Desktop\\LUA\\", "example.zip", "C:\\Users\\bhannan\\Desktop\\ZipExtractionOutput\\") Why does it crash every time it reaches the end?

    Read the article

  • How to capture a screen shot in .NET from a webapplication?

    - by CodeToGlory
    In Java we can do it as follows: import java.awt.Dimension; import java.awt.Rectangle; import java.awt.Robot; import java.awt.Toolkit; import java.awt.image.BufferedImage; import javax.imageio.ImageIO; import java.io.File; ... public void captureScreen(String fileName) throws Exception { Dimension screenSize = Toolkit.getDefaultToolkit().getScreenSize(); Rectangle screenRectangle = new Rectangle(screenSize); Robot robot = new Robot(); BufferedImage image = robot.createScreenCapture(screenRectangle); ImageIO.write(image, "png", new File(fileName)); } ... How do we do this in .NET from a webapplication? Capturing the client's screen and sending it to the server all from within the application.

    Read the article

  • WiX: Extracting Binary-string in Custom Action yields string like "???good data"

    - by leiflundgren
    I just found a weird behaviour when attempting to extract a string from the Binary-table in the MSI. I have a file containing "Hello world", the data I get is "???Hello world". (Literary question mark.) Is this as intended? Will it always be exactly 3 characters in the beginning? Regards Leif Sample code: [CustomAction] public static ActionResult CustomAction2(Session session) { View v = session.Database.OpenView("SELECT `Name`,`Data` FROM `Binary`"); v.Execute(); Record r = v.Fetch(); int datalen = r.GetDataSize("Data"); System.IO.Stream strm = r.GetStream("Data"); byte[] rawData = new byte[datalen]; int res = strm.Read(rawData, 0, datalen); strm.Close(); String s = System.Text.Encoding.ASCII.GetString(rawData); // s == "???Hello World" return ActionResult.Success; }

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • When opening a file in perl, how can I automatically use STDIN/OUT if the file name is "-"?

    - by Ryan Thompson
    I have a perl program that takes input and output file arguments, and I'd like to support the convention of using "-" to specify standard input/output. The problem is that I can't just open the file name, because open(my $input, '<', '-') opens a file called -, not standard input. So I have to do something like this: my $input_fh; if ($input_filename eq '-') { # Special case: get the stdin handle $input_fh = *STDIN{IO}; } else { # Standard case: open the file open($input_fh, '<', $input_filename); } And similarly for the output file. Is there any way to do this without testing for the special case myself? I know I could hack the ARGV filehandle to do this for input, but that won't work for output.

    Read the article

  • Type patterns and generic classes in Haskell

    - by finnsson
    I'm trying to understand type patterns and generic classes in Haskell but can't seem to get it. Could someone explain it in laymen's terms? In [1] I've read that "To apply functions generically to all data types, we view data types in a uniform manner: except for basic predefined types such as Float, IO, and ?, every Haskell data type can be viewed as a labeled sum of possibly labeled products." and then Unit, :*: and :+: are mentioned. Are all data types in Haskell automatically versions of the above mentioned and if so how do I figure out how a specific data type is represented in terms of :*:, etc? The users guide for generic classes (ch. 7.16) at haskell.org doesn't mention the predefined types but shouldn't they be handled in every function if the type patterns should be exhaustive? [1] Comparing Approaches to Generic Programming in Haskell, Ralf Hinze, Johan Jeuring, and Andres Löh

    Read the article

  • How can you tell the source of the data when using the Stream.BeginRead Method?

    - by xarzu
    When using the Stream.BeginRead Method, and you are reading from a stream into a memory, how is it determined where you are reading the data from? See: http://msdn.microsoft.com/en-us/library/system.io.stream.beginread.aspx In the list of parameters, I do not see one that tells where the data is being read from: Parameters buffer Type: System.Byte[] The buffer to read the data into. offset Type: System.Int32 The byte offset in buffer at which to begin writing data read from the stream. count Type: System.Int32 The maximum number of bytes to read. callback Type: System.AsyncCallback An optional asynchronous callback, to be called when the read is complete. state Type: System.Object A user-provided object that distinguishes this particular asynchronous read request from other requests.

    Read the article

  • Redis version on Cloudbees is out of date?

    - by Alan Krueger
    I'm setting up an OSS build in Cloudbees with /usr/sbin/redis-server being started as one of the build tasks: + /usr/sbin/redis-server [204] 04 Nov 03:52:58 # Warning: no config file specified, using the default config. In order to specify a config file use 'redis-server /path/to/redis.conf' [204] 04 Nov 03:52:58 * Server started, Redis version 2.0.3 The (Redis site)[http://redis.io/download] shows 2.6.2 to be the current version and 2.4.17 as "legacy". On the extended downloads page, version 2.0.3 is deprecated. Am I launching it the wrong server executable, or are there plans to support a more recent version of Redis?

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • Better data stream reading in Haskell

    - by Tim Perry
    I am trying to parse an input stream where the first line tells me how many lines of data there are. I'm ending up with the following code, and it works, but I think there is a better way. Is there? main = do numCases <- getLine proc $ read numCases proc :: Integer -> IO () proc numCases | numCases == 0 = return () | otherwise = do str <- getLine putStrLn $ findNextPalin str proc (numCases - 1) Note: The code solves the Sphere problem https://www.spoj.pl/problems/PALIN/ but I didn't think posting the rest of the code would impact the discussion of what to do here.

    Read the article

  • Godaddy's Code sign certificate and MIDlet

    - by abc
    i have developed an application in java (J2ME), and i want trusted domain for that application using goDaddy's certificate. can i obtain it ? let me re describe the full scenario. i have developed an application.in which i want FILE IO operations to be done without the permission of user (for every read write, it means user will be asked only once.) so to obtain that i want trusted domain for my application. for that i need to sign my application using code sign certificate. now go Daddy's certificate is not listed under Nokia 3110Classic, so i have externally added it in CA list. but still its showing app signing option disabled. so my question is can i obtain trusted domain using the goDaddy's code sign certificate ?

    Read the article

  • .Net Designer assemblies, C++\C# error

    - by greggorob64
    I'm working on an designer-heavy application (using Visual C++ 2.0, but a C# solution should still be relevant). My setup is this: I have a UserControl named "Host" I'm attempting a UserControl named "Child" Child contains a property to a class whose type is defined in a different dll entirely, named "mytools.dll" Child works just fine in the designer. However, when I go to drag "child" onto "host" from the designer, I get the following error: Failed to create component 'Child'. The error message follows: 'System.io.filenotfoundexception: could not load file or assembly MyTools, Version XXXXXX, Culture=neutral ..... {unhelpful callstack} If I comment out the property in "child" that points to the class in mytools.dll, everything designs just peachy. I have the property marked with "Browsable(false), and DesignerSerializable(hidden), and it does not help. Is there a way for me to explicitly say "Don't load this dll, you won't need it in design time", or some way for me to force a dll to load from the designer programmatically? Thanks!

    Read the article

< Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >