Search Results

Search found 13778 results on 552 pages for 'numeric format'.

Page 158/552 | < Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >

  • How to do client callback for each item in a foreach statement using c#?

    - by Mike108
    I want to show each item Id that is doing now dynamically in a foreach statement. How to do some kind of client callback to show the item Id in a foreach statement? <asp:Label ID="Label1" runat="server" Text="Label"></asp:Label> <asp:Button ID="Button1" runat="server" onclick="Button1_Click" Text="Button" /> . protected void Button1_Click(object sender, EventArgs e) { List<int> list = new List<int>() { 1,2,3,4,5 }; foreach (var item in list) { Label1.Text = string.Format("I'm doing item {0} now.", item.ToString()); Page.RegisterStartupScript("", string.Format("<script>alert('doing item {0} now')</script>", item.ToString())); Thread.Sleep(1 * 1000); } }

    Read the article

  • Random access gzip stream

    - by jkff
    I'd like to be able to do random access into a gzipped file. I can afford to do some preprocessing on it (say, build some kind of index), provided that the result of the preprocessing is much smaller than the file itself. Any advice? My thoughts were: Hack on an existing gzip implementation and serialize its decompressor state every, say, 1 megabyte of compressed data. Then to do random access, deserialize the decompressor state and read from the megabyte boundary. This seems hard, especially since I'm working with Java and I couldn't find a pure-java gzip implementation :( Re-compress the file in chunks of 1Mb and do same as above. This has the disadvantage of doubling the required disk space. Write a simple parser of the gzip format that doesn't do any decompressing and only detects and indexes block boundaries (if there even are any blocks: I haven't yet read the gzip format description)

    Read the article

  • Flex: Using NumericStepper as an itemEditor in a DataGrid

    - by AlexH
    I am trying to make one field in a datagrid editable with a numeric stepper. My current attempts look like they are working, but the dataProvider is not actually being changed. Based on what I have read in a billion different places, the syntax should be < mx:DataGridColumn dataField="a" itemRenderer="mx.controls.NumericStepper" rendererIsEditor="true" editorDataField="value" / > I have tried several variations on this theme, and nothing seems to work. What am I missing?

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Rails: Need a helping hand to finish this Jquery/Ajax problem.

    - by DJTripleThreat
    Here's my problem: I have a combo box that when its index changes I want a div tag with the id="services" to repopulate with checkboxes based on that comboboxes value. I want this to be done using ajax. This is my first time working with ajax for rails so I need a helping hand. Here is what I have so far: My application.js file. Something that Ryan uses in one of his railscasts. This is supposed to be a helper method for handling ajax requests. Is this useful? Should I be using this?: //<![CDATA[ $.ajaxSetup({ 'beforeSend': function(xhr) {xhr.setRequestHeader("Accept","text/javascript")} }); // This function doesn't return any results. How might I change that? Or // should I have another function to do that? $.fn.submitWithAjax = function() { this.submit(function() { $.post($(this).attr("action"), $(this).serialize(), null, "script"); return true; }); }; //]]> An external javascript file for this template (/public/javascripts/combo_box.js): //<![CDATA[ $(document).ready(function(){ $('#event_service_time_allotment').change(function () { // maybe I should be using submitWithAjax(); ?? $(this).parent().submit(); }); }); //]]> My ???.js.erb file. I'm not sure where this file should go. Should I make an ajax controller?? Someone help me out with that part please. I can write this code no problem, I just need to know where it should go and what the file name should be called (best practices etc): // new.js.erb: dynamic choices... expecting a time_allotment alert('test'); // TODO: Return a json object or something with a result set of services // I should be expecting something like: // params[:event_service][:time_allotment] i think which I should use // to return a json object (??) to be parsed or rendered html // for the div#services. Here is my controller's new action. Am I supposed to respond to javascript here? Should I make an ajax controller instead? What's the best way to do this?: # /app/controllers/event_services_controller.rb def new @event_service = EventService.new respond_to do |format| format.html # new.html.erb format.xml { render :xml => @event_service } format.js # should I have a javascript handler here? i'm lost! end end My /app/views/event_service/new.html.erb. My ajax call I think should be a different action then the form: <% content_for :head do %> <%= javascript_include_tag '/javascripts/combo_box.js' %> <% end %> <% form_for @event_service, :url => admin_events_path, :html => {:method => :post} do |f| %> <!-- TimeAllotment is a tabless model which is why this is done like so... --> <!-- This select produces an id of: "event_service_time_allotment" and a name of: "event_service[time_allotment]" --> <%= select("event_service", "time_allotment", TimeAllotment.all.collect {|ta| [ta.title, ta.value]}, {:prompt => true}) %> Services: <!-- this div right here needs to be repopulated when the above select changes. --> <div id="services"> <% for service_type in ServiceType.all %> <div> <%= check_box_tag "event_service[service_type_ids][]", service_type.id, false %> <%=h service_type.title %> </div> <% end %> </div> <% end %> ok so right now ALL of the services are there to be chosen from. I want them to change based on what is selected in the combobox event_service_time_allotment. Thanks, I know this is super complicated so any helpful answers will get an upvote.

    Read the article

  • Why I get different date formats when I run my application through IIS and Visual Studio's web serve

    - by Puneet Dudeja
    I get the same culture i.e. "en-US" while running the website from both IIS and Visual Studio's web server. But I get a different date format as follows, when I run the following code: HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.ToString()); HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.DateTimeFormat.ShortDatePattern); On Visual Studio's web server: dd/MM/yyyy en-US On IIS: M/d/yyyy en-US Does "Regional and Language Options" in "Control Panel" play any role in this ? If I change the date format there in "Regional and Language Options", I see no effect in my application.

    Read the article

  • Documentation of a software project

    - by anijhaw
    I am working with a team that works on a very large software project, we have tons of Documentation that is written in MS WORD format with nohyperlinked indexes, no search ability. Everyday we waste our time trying to find the exact document or reference. I was thinking if there was way or even a professional tool that would convert all this into a wiki format and maybe with a little manual (painful) help be organised into something that improves the accessibility. I use Google Desktop Search to make my life a little easier but its not the best solution I just want to know if any of you faced similar problems and possible solutions to this issue.

    Read the article

  • Wrap link around links in tweets with php preg_replace

    - by Ben Paton
    Hello I'm trying to display the latest tweet using the code below. This preg_replace works great for wrapping a link round twitter @usernames but doesn't work for web addresses in tweets. How do I get this code to wrap links around urls in tweets. <?php /** Script to pull in the latest tweet */ $username='fairgroceruk'; $format = 'json'; $tweet = json_decode(file_get_contents("http://api.twitter.com/1/statuses/user_timeline/{$username}.{$format}")); $latestTweet = htmlentities($tweet[0]->text, ENT_QUOTES); $latestTweet = preg_replace('/@([a-z0-9_]+)/i', '<a href="http://twitter.com/$1" target="_blank">@$1</a>', $latestTweet); $latestTweet = preg_replace('/http://([a-z0-9_]+)/i', '<a href="http://$1" target="_blank">http://$1</a>', $latestTweet); echo $latestTweet; ?> Thanks for the help, Ben

    Read the article

  • Associated models in Rails?

    - by dannymcc
    Hi Everyone, In my rails application I have two models called Kases and Notes. They work in the same way comments do with blog posts, I.e. each Kase entry can have multiple notes attached to it. I have got everything working, but for some reason I cannot get the destroy link to work for the Notes. I think I am overlooking something that is different with associated models to standard models. Notes Controller class NotesController < ApplicationController # POST /notes # POST /notes.xml def create @kase = Kase.find(params[:kase_id]) @note = @kase.notes.create!(params[:note]) respond_to do |format| format.html { redirect_to @kase } format.js end end end Kase Model class Kase < ActiveRecord::Base validates_presence_of :jobno has_many :notes Note Model class Note < ActiveRecord::Base belongs_to :kase end In the Kase show view I call a partial within /notes called _notes.html.erb: Kase Show View <div id="notes"> <h2>Notes</h2> <%= render :partial => @kase.notes %> <% form_for [@kase, Note.new] do |f| %> <p> <h3>Add a new note</h3> <%= f.text_field :body %><%= f.submit "Add Note" %> </p> <% end %> </div> /notes/_note.html.erb <% div_for note do %> <div id="sub-notes"> <p> <%= h(note.body) %><br /> <span style="font-size:smaller">Created <%= time_ago_in_words(note.created_at) %> ago on <%= note.created_at %></span> </p> <%= link_to "Remove Note", kase_path(@kase), :confirm => 'Are you sure?', :method => :delete, :class => 'important' %> </div> <% end %> As you can see, I have a Remove Note destroy link, but that destroys the entire Kase the note is associated with. How do I make the destroy link remove only the note? <%= link_to "Remove Note", kase_path(@kase), :confirm => 'Are you sure?', :method => :delete, :class => 'important' %> Any help would, as always, be greatly appreciated! Thanks, Danny

    Read the article

  • PHP Arrays: A good way to check if an array is associative or sequential?

    - by Wilco
    PHP treats all arrays as associative, so there aren't any built in functions. Can anyone recommend a fairly efficient way to check if an array contains only numeric keys? Basically, I want to be able to differentiate between this: $sequentialArray = array('apple', 'orange', 'tomato', 'carrot'); and this: $assocArray = array('fruit1' => 'apple', 'fruit2' => 'orange', 'veg1' => 'tomato', 'veg2' => 'carrot');

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How stable are Cisco IOS OIDs for querying data with SNMP across different model devices?

    - by Daniel Papasian
    I'm querying a bunch of information from cisco switches using SNMP. For instance, I'm pulling information on neighbors detected using CDP by doing an snmpwalk on .1.3.6.1.4.1.9.9.23 Can I use this OID across different cisco models? What pitfalls should I be aware of? To me, I'm a little uneasy about using numeric OIDs - it seems like I should be using a MIB database or something and using the named OIDs, in order to gain cross-device compatibility, but perhaps I'm just imagining the need for that.

    Read the article

  • How can I put rows of MySQL data under the appropriate titles using PHP?

    - by sfarbota
    I have the following MySQL table structure: num field company phone website 1 Gas abcd 123456789 abcd.com 2 Water efgh 987654321 efgh.com 3 Water ijkl 321654987 ijkl.com 4 Heat mnop 987654321 mnop.com 5 Gas qrst 123789654 qrst.com ... Is it possible with PHP (maybe using some mixture of GROUP_BY and ORDER_BY) to echo the data to the screen in the following format: Gas: abcd qrst 123456789 123789654 abcd.com qrst.com Water: efgh ijkl 987654321 321654987 efgh.com ijkl.com Heat: mnop 321654987 mnop.com The exact format of it isn't important. I just need for the different rows of data to be listed under the appropriate field with none of the fields repeated. I've been trying to figure this out for a while now, but I'm new to PHP and I can't seem to figure out how to do this, if it's even possible, or if there's a better way to organize my data to make it easier.

    Read the article

  • How to query a date in HQL (Hibernate) with Joda Time?

    - by fabien7474
    I am sure that someone familiar with HQL (I am myself a newbie) can easily answer this question. In my Grails application, I have the following domain class. class Book { org.joda.time.DateTime releaseDate //I use the PersistentDateTime for persisting via Hibernate (that use a DATETIME type for MySQL DB) } In my HQL query, I want to retrieve books whose release date is included in range date1..date2 For instance I tried: DateTime date1, date2 ... def queryStr = "select * from Book as b where b.releaseDate > $date1 and b.releaseDate < $date2" def res = Book.executeQuery(queryStr) But I got the exception ...caused by: org.springframework.orm.hibernate3.HibernateQueryException: unexpected token: The error token points to date format (for instance 2009-11-27T21:57:18.010+01:00 or Fri Nov 27 22:01:20 CET 2009) I have also tried to convert date1 into a Date class without success So what is the correct HQL code ? Should I convert to a specific format (which one?) using the patternForStyle method or is there another -cleaner- way to do it? Thanks, Fabien.

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

  • Convert Date to Datetime field.

    - by infant programmer
    The argument my C# function is getting is a string which is merely a Date or a DateTime. I am suppose to convert this String to DateTime, to carry on furthure calculation. Now I need to test whether the incoming data is a Date, if it is date(examle:"12/31/2009"), then I need to add "00:00:00" (24 hours format) to it, so that it will become "12/31/2009 00:00:00". If string manipulation is one possible way, I want to confirm whether there is some other way where we can automate the testing and conversion within DateTime.TryParseExact() method. This is my sample C# code : (which is now only able to convert string of format "MM/dd/yyyy HH:mm:ss" to DateTime.) private static string[] formats = new string[] { "MM/dd/yyyy HH:mm:ss" }; public string date_conv(string date_str) { DateTime date_value; DateTime.TryParseExact(date_str, formats, new global::System.Globalization.CultureInfo("en-US"), global::System.Globalization.DateTimeStyles.None, out date_value); /*Some useful instruction to use date_value*/ return(date_value.ToString("MM/dd/yyyy HH:mm:ss")); }

    Read the article

  • Are there any modern platforms with non-IEEE C/C++ float formats?

    - by Patrick Niedzielski
    Hi all, I am writing a video game, Humm and Strumm, which requires a network component in its game engine. I can deal with differences in endianness easily, but I have hit a wall in attempting to deal with possible float memory formats. I know that modern computers have all a standard integer format, but I have heard that they may not all use the IEEE standard for floating-point integers. Is this true? While certainly I could just output it as a character string into each packet, I would still have to convert to a "well-known format" of each client, regardless of the platform. The standard printf() and atod() would be inadequate. Please note, because this game is a Free/Open Source Software program that will run on GNU/Linux, *BSD, and Microsoft Windows, I cannot use any proprietary solutions, nor any single-platform solutions. Cheers, Patrick

    Read the article

  • Stop method not working

    - by avoq
    Hi everyone , can anybody tell me why the following code doesn't work properly? I want to play and stop an audio file. I can do the playback but whenever I click the stop button nothing happens. Here's the code : Thank you. .................. import java.io.*; import javax.sound.sampled.*; import javax.swing.*; import java.awt.event.*; public class SoundClipTest extends JFrame { final JButton button1 = new JButton("Play"); final JButton button2 = new JButton("Stop"); int stopPlayback = 0; // Constructor public SoundClipTest() { button1.setEnabled(true); button2.setEnabled(false); // button play button1.addActionListener( new ActionListener(){ public void actionPerformed(ActionEvent e){ button1.setEnabled(false); button2.setEnabled(true); play(); }// end actionPerformed }// end ActionListener );// end addActionListener() // button stop button2.addActionListener( new ActionListener(){ public void actionPerformed( ActionEvent e){ //Terminate playback before EOF stopPlayback = 1; }//end actionPerformed }//end ActionListener );//end addActionListener() this.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); this.setTitle("Test Sound Clip"); this.setSize(300, 200); JToolBar bar = new JToolBar(); bar.add(button1); bar.add(button2); bar.setOrientation(JToolBar.VERTICAL); add("North", bar); add("West", bar); setVisible(true); } void play() { try { final File inputAudio = new File("first.wav"); // First, we get the format of the input file final AudioFileFormat.Type fileType = AudioSystem.getAudioFileFormat(inputAudio).getType(); // Then, we get a clip for playing the audio. final Clip c = AudioSystem.getClip(); // We get a stream for playing the input file. AudioInputStream ais = AudioSystem.getAudioInputStream(inputAudio); // We use the clip to open (but not start) the input stream c.open(ais); // We get the format of the audio codec (not the file format we got above) final AudioFormat audioFormat = ais.getFormat(); c.start(); if (stopPlayback == 1 ) {c.stop();} } catch (UnsupportedAudioFileException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (LineUnavailableException e) { e.printStackTrace(); } }// end play public static void main(String[] args) { //new SoundClipTest().play(); new SoundClipTest(); } }

    Read the article

  • Refreshing a binding that uses a value converter

    - by Hadi Eskandari
    I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

    Read the article

  • How to set the Windows Mobile 6 IME mode (to numbers only)

    - by Daniel Crenna
    In Windows Mobile 5 one of the following methods works to set an input to numbers only: // Managed InputModeEditor.SetInputMode(textBox, InputMode.Numeric); // Native Wrapper InputModeSupport.SHSetImeMode(textBox.Handle, InputModeSupport.SHIME_MODE.SHIME_MODE_NUMBERS); In Windows Mobile 6, neither works. How do you set the IME to "Numbers Only" in WM 6.0 / .NET CF 3.5?

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • The dictionary need to add every word in SpellingMistakes and the line number but it only adds the l

    - by Will Boomsight
    modules import sys import string Importing and reading the files form the Command Prompt Document = open(sys.argv[1],"r") Document = open('Wc.txt', 'r') Document = Document.read().lower() Dictionary = open(sys.argv[2],"r") Dictionary = open('Dict.txt', 'r') Dictionary = Dictionary.read() def Format(Infile): for ch in string.punctuation: Infile = Infile.replace(ch, "") for no in string.digits: Infile = Infile.replace(no, " ") Infile = Infile.lower() return(Infile) def Corrections(Infile, DictWords): Misspelled = set([]) Infile = Infile.split() DictWords = DictWords.splitlines() for word in Infile: if word not in DictWords: Misspelled.add(word) Misspelled = sorted(Misspelled) return (Misspelled) def Linecheck(Infile,ErrorWords): Infile = Infile.split() lineno = 0 Noset = list() for line in Infile: lineno += 1 line = line.split() for word in line: if word == ErrorWords: Noset.append(lineno) sorted(Noset) return(Noset) def addkey(error,linenum): Nodict = {} for line in linenum: Nodict.setdefault(error,[]).append(linenum) return Nodict FormatDoc = Format(Document) SpellingMistakes = Corrections(FormatDoc,Dictionary) alp = str(SpellingMistakes) for word in SpellingMistakes: nSet = str(Linecheck(FormatDoc,word)) nSet = nSet.split() linelist = addkey(word, nSet) print(linelist) # # for word in Nodict.keys(): # Nodict[word].append(line) Prints each incorrect word on a new line

    Read the article

  • PHP Fomatting Regex - BBCode

    - by Wayne
    To be honest, I suck at regex so much, I would use RegexBuddy, but I'm working on my Mac and sometimes it doesn't help much (for me). Well, for what I need to do is a function in php function replaceTags($n) { $n = str_replace("[[", "<b>", $n); $n = str_replace("]]", "</b>", $n); } Although this is a bad example in case someone didn't close the tag by using ]] or [[, anyway, could you help with regex of: [[ ]] = Bold format ** ** = Italic format (( )) = h2 heading Those are all I need, thanks :) P.S - Is there any software like RegexBuddy available for Mac (Snow Leopard)?

    Read the article

< Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >