Search Results

Search found 13778 results on 552 pages for 'numeric format'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 159/552 | < Previous Page | 155 156 157 158 159 160 161 162 163 164 165 166  | Next Page >

  • Refreshing a binding that uses a value converter

    - by Hadi Eskandari
    I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

    Read the article

  • PHP Arrays: A good way to check if an array is associative or sequential?

    - by Wilco
    PHP treats all arrays as associative, so there aren't any built in functions. Can anyone recommend a fairly efficient way to check if an array contains only numeric keys? Basically, I want to be able to differentiate between this: $sequentialArray = array('apple', 'orange', 'tomato', 'carrot'); and this: $assocArray = array('fruit1' => 'apple', 'fruit2' => 'orange', 'veg1' => 'tomato', 'veg2' => 'carrot');

    Read the article

  • Best practice. Do I save html tags in DB or store the html entity value?

    - by Matt
    Hi Guys, I was wondering about which way i should do the following. I am using the tiny MCE wysiwyg editor which formats the users data with the right html tags. Now, i need to save this data entered into the editor into a database table. Should I encode the html tags to their corresponding entities when inserting into the DB, then when i get the data back from the table, not have the encode it for XSS purposes but I'd still have to use eval for the html tags to format the text. OR Do i save the html tags into the database, then when i get the data back from the database encode the html tags to their entities, but then as the tags will appear to the user, I'd have to use the eval function to actually format the data as it was entered. My thoughts are with the first option, I just wondered on what you guys thought.

    Read the article

  • Loop over a file and write the next line if a condition is met

    - by 111078384259264152964
    Having a hard time fixing this or finding any good hints about it. I'm trying to loop over one file, modify each line slightly, and then loop over a different file. If the line in the second file starts with the line from the first then the following line in the second file should be written to a third file. !/usr/bin/env python with open('ids.txt', 'rU') as f: with open('seqres.txt', 'rU') as g: for id in f: id=id.lower()[0:4]+'_'+id[4] with open(id + '.fasta', 'w') as h: for line in g: if line.startswith(''+ id): h.write(g.next()) All the correct files appear, but they are empty. Yes, I am sure the if has true cases. :-) "seqres.txt" has lines with an ID number in a certain format, each followed by a line with data. The "ids.txt" has lines with the ID numbers of interest in a different format. I want each line of data with an interesting ID number in its own file. Thanks a million to anyone with a little advice!

    Read the article

  • What products support 3-digit region subtags, e.g., es-419 for Latin-American Spanish?

    - by Ektron Doug D
    What products support 3-digit region subtags, e.g., es-419 for Latin-American Spanish? Are web browsers, translation tools and translators familiar with these numeric codes in addition to the more common "es" or "es-ES"? I've already visited the following pages: W3C Choosing a Language Tag W3C Language tags in HTML and XML RFC 5646 Tags for Identifying Languages Microsoft National Language Support (NLS) API Reference

    Read the article

  • How to use Delphi's AsCurrency to show currency without currency symbol?

    - by croceldon
    I'm trying to display a currency value in a grid, but I do not want the currency symbol to be shown: if fPreferences.WorksheetFormat = 'Numeric' then begin CurrencyString := ''; Value := FieldByName('UnitList').AsCurrency; end else Value := CurrToStrF(FieldByName('UnitList').AsCurrency, ffCurrency, 2, langFormat); The problem is that it's still showing the currency symbol. What am I doing wrong here? I don't think I can use CurrToStrF, because I need the grid to export a number to excel, not a string.

    Read the article

  • PHP Fomatting Regex - BBCode

    - by Wayne
    To be honest, I suck at regex so much, I would use RegexBuddy, but I'm working on my Mac and sometimes it doesn't help much (for me). Well, for what I need to do is a function in php function replaceTags($n) { $n = str_replace("[[", "<b>", $n); $n = str_replace("]]", "</b>", $n); } Although this is a bad example in case someone didn't close the tag by using ]] or [[, anyway, could you help with regex of: [[ ]] = Bold format ** ** = Italic format (( )) = h2 heading Those are all I need, thanks :) P.S - Is there any software like RegexBuddy available for Mac (Snow Leopard)?

    Read the article

  • How to get JSON back from HTTP POST Request (to another domain)

    - by roman m
    I'm trying to use the API on a website, here's the part of the manual: Authenticated Sessions (taken from here) To create an authenticated session, you need to request an authToken from the '/auth' API resource. URL: http://stage.amee.com/auth (this is not my domain) Method: POST Request format: application/x-www-form-urlencoded Response format: application/xml, application/json Response code: 200 OK Response body: Details of the authenticated user, including API version. Extra data: "authToken" cookie and header, containing the authentication token that should be used for subsequent calls. Parameters: username / password Example Request POST /auth HTTP/1.1 Accept: application/xml Content-Type: application/x-www-form-urlencoded username=my_username&password=my_password Response HTTP/1.1 200 OK Set-Cookie: authToken=1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/Pm...; authToken: 1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/PmEvzkPGp...== Content-Type: application/xml; charset=UTF-8 QUESTION: How do I get that to work? I tried jQuery, but it seems to have problem with XSS. Actual code snippet would be greatly appreciated. p.s. All I was looking for was WebClient class in C#

    Read the article

  • mmap() for large file I/O?

    - by Boatzart
    I'm creating a utility in C++ to be run on Linux which can convert videos to a proprietary format. The video frames are very large (up to 16 megapixels), and we need to be able to seek directly to exact frame numbers, so our file format uses libz to compress each frame individually, and append the compressed data onto a file. Once all frames are finished being written, a journal which includes meta data for each frame (including their file offsets and sizes) is written to the end of the file. I'm currently using ifstream and ofstream to do the file i/o, but I am looking to optimize as much as possible. I've heard that mmap() can increase performance in a lot of cases, and I'm wondering if mine is one of them. Our files will be in the tens to hundreds of gigabytes, and although writing will always be done sequentially, random access reads should be done in constant time. Any thoughts as to whether I should investigate this further, and if so does anyone have any tips for things to look out for? Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • API for accessing PHP documentation?

    - by Chad Johnson
    I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • Use boost date_time to parse and create HTTP-dates

    - by John Price
    I'm writing a kind of HTTP proxy, so I need to be able to do 3 things: Parse an HTTP-date given any of the 3 formats specified in RFC 2616, sec 3.3, Convert a file date-time to an HTTP-date string, and Output the date to a string. For reference, theses are examples of the date-times I need to parse. I will output only the first format: Sun, 06 Nov 1994 08:49:37 GMT ; RFC 822, updated by RFC 1123 Sunday, 06-Nov-94 08:49:37 GMT ; RFC 850, obsoleted by RFC 1036 Sun Nov 6 08:49:37 1994 ; ANSI C's asctime() format I'm pretty sure Boost date_time can do all of this, but I'm having some trouble with number 1. Does anyone already have code to do this? Perhaps I'm not using google proficiently, but I can't find an example of how to do this with boost anywhere. Thanks for any help!

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • How to send a Timestamp field to Oracle stored proc. from Java despite the DB config?

    - by Alfabravo
    I'm making a request from a java webapp to an Oracle' stored procedure which happens to have a Timestamp IN parameter. In the testing environment, it works sending: SimpleDateFormat dateFormat = new SimpleDateFormat("dd-MMM-yyyy hh:mm:ss a"); input.setTimestampField(dateFormat.format(new Date())); But in the production environment, it raises an exception ORA-01830: date format picture ends before converting entire input string. I know the testing environment should be a replica of the production site, but it is not in my hands to set them properly. And I need to send the Timestamp field despite the way they setup the database. Any ideas? Thanks in advance.

    Read the article

  • current_date casting

    - by Armen Mkrtchyan
    Hi. string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < current_date;"; when i call current_date, it return yyyy-MM-dd format, but i want to return dd.MM.yyyy format, how can i do that. please help. my program works fine when i am trying string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < '16.04.2010';";

    Read the article

  • R: Using sapply on vector of POSIXct

    - by Chris
    I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

    Read the article

  • Are there any modern platforms with non-IEEE C/C++ float formats?

    - by Patrick Niedzielski
    Hi all, I am writing a video game, Humm and Strumm, which requires a network component in its game engine. I can deal with differences in endianness easily, but I have hit a wall in attempting to deal with possible float memory formats. I know that modern computers have all a standard integer format, but I have heard that they may not all use the IEEE standard for floating-point integers. Is this true? While certainly I could just output it as a character string into each packet, I would still have to convert to a "well-known format" of each client, regardless of the platform. The standard printf() and atod() would be inadequate. Please note, because this game is a Free/Open Source Software program that will run on GNU/Linux, *BSD, and Microsoft Windows, I cannot use any proprietary solutions, nor any single-platform solutions. Cheers, Patrick

    Read the article

  • How does the iPhone SDK Core Data system store date types to sqlite?

    - by Andrew Arrow
    I used core data to do this: NSManagedObjectContext *m = [self managedObjectContext]; Foo *f = (Foo *)[NSEntityDescription insertNewObjectForEntityForName:@"Foo" inManagedObjectContext:m]; f.created_at = [NSDate date]; [m insertObject:f]; NSError *error; [m save:&error]; Where the created_at field is defined as type "Date" in the xcdatamodel. When I export the sql from the sqlite database it created, created_at is defined as type "timestamp" and the values look like: 290902422.72624 Nine digits before the . and then some fraction. What is this format? It's not epoch time and it's not julianday format. Epoch would be: 1269280338.81213 julianday would be: 2455278.236746875 (notice only 7 digits before the . not 9 like I have) How can I convert a number like 290902422.72624 to epoch time? Thanks!

    Read the article

  • Microsoft Word Document Controls not accepting carriage returns

    - by Scott
    So, I have a Microsoft Word 2007 Document with several Plain Text Format (I have tried Rich Text Format as well) controls which accept input via XML. For carriage returns, I had the string being passed through XML containing "\r\n" when I wanted a carriage return, but the word document ignored that and just kept wrapping things on the same line. I also tried replacing the \r\n with System.Environment.NewLine in my C# mapper, but that just put in \r\n anyway, which still didn't work. Note also that on the control itself I have set it to "Allow Carriage Returns (Multiple Paragrpahs)" in the control properties. This is the XML for the listMapper <Field id="32" name="32" fieldType="SimpleText"> <DataSelector path="/Data/DB/DebtProduct"> <InputField fieldType="" path="/Data/DB/Client/strClientFirm" link="" type=""/> <InputField fieldType="" path="strClientRefDebt" link="" type=""/> </DataSelector> <DataMapper formatString="{0} Account Number: {1}" name="SimpleListMapper" type=""> <MapperData> </MapperData> </DataMapper> </Field> Note that this is the listMapper C# where I actually map the list (notice where I try and append the system.environment.newline) namespace DocEngine.Core.DataMappers { public class CSimpleListMapper:CBaseDataMapper { public override void Fill(DocEngine.Core.Interfaces.Document.IControl control, CDataSelector dataSelector) { if (control != null && dataSelector != null) { ISimpleTextControl textControl = (ISimpleTextControl)control; IContent content = textControl.CreateContent(); CInputFieldCollection fileds = dataSelector.Read(Context); StringBuilder builder = new StringBuilder(); if (fileds != null) { foreach (List<string> lst in fileds) { if (CanMap(lst) == false) continue; if (builder.Length > 0 && lst[0].Length > 0) builder.Append(Environment.NewLine); if (string.IsNullOrEmpty(FormatString)) builder.Append(lst[0]); else builder.Append(string.Format(FormatString, lst.ToArray())); } content.Value = builder.ToString(); textControl.Content = content; applyRules(control, null); } } } } } Does anybody have any clue at all how I can get MS Word 2007 (docx) to quit ignoring my newline characters??

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 155 156 157 158 159 160 161 162 163 164 165 166  | Next Page >