Search Results

Search found 13757 results on 551 pages for 'decimal format'.

Page 164/551 | < Previous Page | 160 161 162 163 164 165 166 167 168 169 170 171  | Next Page >

  • How to convert raw_input() into a directory?

    - by Azeworai
    Hi everyone, I just picked up IronPython and I've been trying to get this IronPython script going but I'm stuck at trying to get a Path input from raw_input to be a directory path. The first block of code is the broken one that I'm working on. import System from System import * from System.IO import * from System.Diagnostics import * inputDirectory = raw_input("Enter Input Directory's full path [eg. c:\\vid\\]: ") print ("In: "+inputDirectory) outputDirectory = inputDirectory +"ipod\\" print ("Out: "+outputDirectory) #create the default output directory for s in DirectoryInfo(inputDirectory).GetFiles("*.avi"): print s.FullName arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, outputDirectory + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() The following code block is what I have working at the moment. import System from System import * from System.IO import * from System.Diagnostics import * for s in DirectoryInfo("F:\\Tomorrow\\").GetFiles("*.avi"): arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, "F:\\Tomorrow\\ipod\\" + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() PS: Credit for the above working code goes to Joseph at jcooney.net

    Read the article

  • Why the current working directory changes when use the Open file dialog in XP?

    - by RRUZ
    I have found an strange behavior when use the open file dialog in c#. If use this code in Windows XP the current working directory changes to the path of the selected file, however if you run this code in windows 7 the current working directory does not change. private void button1_Click(object sender, EventArgs e) { MessageBox.Show(string.Format("Current Directory {0}",Directory.GetCurrentDirectory()), "My Application",MessageBoxButtons.OK, MessageBoxIcon.Asterisk); DialogResult result = openFileDialog1.ShowDialog(); // Show the dialog and get result. if (result == DialogResult.OK) { } MessageBox.Show(string.Format("Current Directory {0}", Directory.GetCurrentDirectory()), "My Application", MessageBoxButtons.OK, MessageBoxIcon.Asterisk); } Anybody know the reason for this behavior? Why the current directoiry changes in XP and not in windows 7?

    Read the article

  • Best tool to check and ensure PDF/A compatibility under Linux

    - by Sven Lilienthal
    I am working on an online portal, where researchers can upload their research papers. One requirement is, that all PDFs are stored in PDF/A-format. As I can't rely on the users to generate PDF/A conforming documents, I need a tool to check and convert standard PDFs into PDF/A format. What is the best tool you know of? Price Quality Speed Available APIs Open-source tools would be prefered, but a search revealed none. iText can create PDF/a, but converting isn't easy to do, as you have to read every page and copy it to a new document, losing all bookmarks and annotations in this process. (At least as far as I know, if you know of an easy solution, let me know). APIs should be available for either PHP, Java or a command-line-tool should be provided. Please do not list either GUI-only or Online-only solutions.

    Read the article

  • Problem in displaying numbers in Flex AdvancedDataGrid

    - by user211607
    Hi, I am able to display any data (numbers) in Flex AdvancedDataGrid except data with lot of digits after decimal places (0.000000000029103830456733704) or exponential numbers (293E-17). Grid is displaying -17 instead of 293E-17. Is it happening because of any limit to displaying data range in grid? If yes, what is the limit? Thanks in advance ... Atul

    Read the article

  • Is it possible to temporarily disable Python's string interpolation?

    - by dangerouslyfacetious
    I have a python logger set up, using python's logging module. I want to store the string I'm using with the logging Formatter object in a configuration file using the ConfigParser module. The format string is stored in a dictionary of settings in a separate file that handles the reading and writing of the config file. The problem I have is that python still tries to format the file and falls over when it reads all the logging-module-specific formatting flags. { "log_level":logging.debug, "log_name":"C:\\Temp\\logfile.log", "format_string": "%(asctime)s %(levelname)s: %(module)s, line %(lineno)d - %(message)s" } My question is simple: how can I disable the formatting functionality here while keeping it elsewhere. My initial reaction was copious use of the backslash to escape the various percent symbols, but that of course permanently breaks the formatting such that it wont work even when I need it to. Also, general pointers on good settings-file practices would be nice. This is the first time I've done anything significant with ConfigParser (or logging for that matter). Thanks in advance, Dominic

    Read the article

  • transition of x-axis results in overflow

    - by peter
    First of all, no: this question is not about the (yet) ugly transition of the lines (I might open another one for that, though..). I'm displaying data in line charts and the user can select the time horizon. The x-axis then correspondingly transitions so as to fit to the changed time horizon. In attached image, e.g., the time horizon was 1 week and then I switched to 4 weeks. The number of ticks on the x-axis increases from 7 to 28, correspondingly. Question: How can I prevent the x-axis animation to display outside the svg container? As you can see, the additional dates fly in from the left and they are being animated far far outside the container. Any ideas? Right now, the transition works probably in the most simple way it could: // format for x-axis var xAxis = d3.svg.axis() .scale(x) .orient("bottom") .tickFormat(d3.time.format("%d.%m")) .ticks(d3.time.days, 1) .tickSubdivide(0); // Update x-axis svg.select(".x") .transition() .duration(500) .call(xAxis);

    Read the article

  • How to do client callback for each item in a foreach statement using c#?

    - by Mike108
    I want to show each item Id that is doing now dynamically in a foreach statement. How to do some kind of client callback to show the item Id in a foreach statement? <asp:Label ID="Label1" runat="server" Text="Label"></asp:Label> <asp:Button ID="Button1" runat="server" onclick="Button1_Click" Text="Button" /> . protected void Button1_Click(object sender, EventArgs e) { List<int> list = new List<int>() { 1,2,3,4,5 }; foreach (var item in list) { Label1.Text = string.Format("I'm doing item {0} now.", item.ToString()); Page.RegisterStartupScript("", string.Format("<script>alert('doing item {0} now')</script>", item.ToString())); Thread.Sleep(1 * 1000); } }

    Read the article

  • Random access gzip stream

    - by jkff
    I'd like to be able to do random access into a gzipped file. I can afford to do some preprocessing on it (say, build some kind of index), provided that the result of the preprocessing is much smaller than the file itself. Any advice? My thoughts were: Hack on an existing gzip implementation and serialize its decompressor state every, say, 1 megabyte of compressed data. Then to do random access, deserialize the decompressor state and read from the megabyte boundary. This seems hard, especially since I'm working with Java and I couldn't find a pure-java gzip implementation :( Re-compress the file in chunks of 1Mb and do same as above. This has the disadvantage of doubling the required disk space. Write a simple parser of the gzip format that doesn't do any decompressing and only detects and indexes block boundaries (if there even are any blocks: I haven't yet read the gzip format description)

    Read the article

  • Using Rails 3 and Haml 3, how do I configure Haml?

    - by dpogg1
    I'm using Rails 3.0.0.beta3 and Haml 3.0.0.rc.2, and I can't find where I need to place the configuration lines for Haml (nor what they are in the new version, for that matter). Using Rails 2.3.5 and Haml 2, I would do Haml::Template.options[:format] = :html5 in environment.rb. Or, in Sinatra, set :haml, {:format => :html5} in my main file. But in Rails 3 everything's been changed around, and no matter where I put that configuration line, I get an undefined method or undefined object error.

    Read the article

  • Rails: Need a helping hand to finish this Jquery/Ajax problem.

    - by DJTripleThreat
    Here's my problem: I have a combo box that when its index changes I want a div tag with the id="services" to repopulate with checkboxes based on that comboboxes value. I want this to be done using ajax. This is my first time working with ajax for rails so I need a helping hand. Here is what I have so far: My application.js file. Something that Ryan uses in one of his railscasts. This is supposed to be a helper method for handling ajax requests. Is this useful? Should I be using this?: //<![CDATA[ $.ajaxSetup({ 'beforeSend': function(xhr) {xhr.setRequestHeader("Accept","text/javascript")} }); // This function doesn't return any results. How might I change that? Or // should I have another function to do that? $.fn.submitWithAjax = function() { this.submit(function() { $.post($(this).attr("action"), $(this).serialize(), null, "script"); return true; }); }; //]]> An external javascript file for this template (/public/javascripts/combo_box.js): //<![CDATA[ $(document).ready(function(){ $('#event_service_time_allotment').change(function () { // maybe I should be using submitWithAjax(); ?? $(this).parent().submit(); }); }); //]]> My ???.js.erb file. I'm not sure where this file should go. Should I make an ajax controller?? Someone help me out with that part please. I can write this code no problem, I just need to know where it should go and what the file name should be called (best practices etc): // new.js.erb: dynamic choices... expecting a time_allotment alert('test'); // TODO: Return a json object or something with a result set of services // I should be expecting something like: // params[:event_service][:time_allotment] i think which I should use // to return a json object (??) to be parsed or rendered html // for the div#services. Here is my controller's new action. Am I supposed to respond to javascript here? Should I make an ajax controller instead? What's the best way to do this?: # /app/controllers/event_services_controller.rb def new @event_service = EventService.new respond_to do |format| format.html # new.html.erb format.xml { render :xml => @event_service } format.js # should I have a javascript handler here? i'm lost! end end My /app/views/event_service/new.html.erb. My ajax call I think should be a different action then the form: <% content_for :head do %> <%= javascript_include_tag '/javascripts/combo_box.js' %> <% end %> <% form_for @event_service, :url => admin_events_path, :html => {:method => :post} do |f| %> <!-- TimeAllotment is a tabless model which is why this is done like so... --> <!-- This select produces an id of: "event_service_time_allotment" and a name of: "event_service[time_allotment]" --> <%= select("event_service", "time_allotment", TimeAllotment.all.collect {|ta| [ta.title, ta.value]}, {:prompt => true}) %> Services: <!-- this div right here needs to be repopulated when the above select changes. --> <div id="services"> <% for service_type in ServiceType.all %> <div> <%= check_box_tag "event_service[service_type_ids][]", service_type.id, false %> <%=h service_type.title %> </div> <% end %> </div> <% end %> ok so right now ALL of the services are there to be chosen from. I want them to change based on what is selected in the combobox event_service_time_allotment. Thanks, I know this is super complicated so any helpful answers will get an upvote.

    Read the article

  • Developing ebooks- software?

    - by Mark Mayo
    I've written a few documents for friends or blogs on software testing, job hunting and android development. I've been toying with the idea of producing some programming-related ebooks. However, developing these in Word or OpenOffice seems too amateurish compared to some of the fantastically produced books out there. I'm proficient in LaTeX but have never seen it used to produce ... 'marketable' works - just technical papers, maths, etc - which is great for code but not for distribution. Has anyone seen any good (preferably free / open source) tool or software for developing/compiling professional-looking marketable ebooks (probably to .pdf or .exe format - but I can take care of that part if need be)? And more importantly, ones that are easy to use to format any code samples or snippets that I may choose to include. Much appreciated.

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Wrap link around links in tweets with php preg_replace

    - by Ben Paton
    Hello I'm trying to display the latest tweet using the code below. This preg_replace works great for wrapping a link round twitter @usernames but doesn't work for web addresses in tweets. How do I get this code to wrap links around urls in tweets. <?php /** Script to pull in the latest tweet */ $username='fairgroceruk'; $format = 'json'; $tweet = json_decode(file_get_contents("http://api.twitter.com/1/statuses/user_timeline/{$username}.{$format}")); $latestTweet = htmlentities($tweet[0]->text, ENT_QUOTES); $latestTweet = preg_replace('/@([a-z0-9_]+)/i', '<a href="http://twitter.com/$1" target="_blank">@$1</a>', $latestTweet); $latestTweet = preg_replace('/http://([a-z0-9_]+)/i', '<a href="http://$1" target="_blank">http://$1</a>', $latestTweet); echo $latestTweet; ?> Thanks for the help, Ben

    Read the article

  • PIL saves image colour wrong

    - by Tom Viner
    I have an image. I want to resize it using PIL, but it come out like this. Even without a resize it still messes up the colour. Minimal code: from PIL import Image import os import urllib import webbrowser orig_url = 'http://mercedesclub.org.uk/images/stackoverflow-question/least-popular-colours-_-500-x-500.jpg' temp_fn, _ = urllib.urlretrieve(orig_url) im = Image.open(temp_fn) fn = os.tempnam() + '.jpg' im.save(fn) webbrowser.open(fn) I've tried Image.open(temp_fn).convert(format) with 'RGB', 'CMYK' and 'L' as formats, but still get weirdly coloured or grey results. When I load the image from my hard drive and I can see: >>>im.info {'adobe': 100, 'progression': 1, 'exif': 'Exif\x00\x00MM\x00*...\x7f\xff\xd9', 'adobe_transform': 100} >>>im.format 'JPEG' >>>im.mode 'CMYK' >>> im._getexif() {40961: 65535, 40962: 500, 40963: 500, 296: 2, 34665: 164, 274: 1, 305: 'Adobe Photoshop CS Macintosh', 306: '2010:02:26 12:46:54', 282: (300, 1), 283: (300, 1)} Thanks and let me know if you need any more data.

    Read the article

  • NSNumberFormatter to display custom labels for 10^n (10000 -> 10k)

    - by Michele Colombo
    I need to display numbers on a plot axis. The values could change but I want to avoid too long numbers that will ruin the readability of the graph. My thought was to group every 3 characters and substitute them with K, M and so on (or a custom character). So: 1 - 1, 999 - 999, 1.000 - 1k, 1.200 - 1.2k, 1.280 - 1.2k, 12.800 - 12.8k, 999.999 - 999.9k, 1.000.000 - 1M, ... Note that probably I'll only need to format round numbers (1, 10, 1000, 1500, 2000, 10000, 20000, 30000, 100000, ...). Is that possibile with NSNumberFormatter? I saw that it has a setFormat method but I don't know how much customizable it is. I'm using NSNumberFormatter cause the graph object I use wants it to set label format and I want to avoid changing my data to set the label.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why I get different date formats when I run my application through IIS and Visual Studio's web serve

    - by Puneet Dudeja
    I get the same culture i.e. "en-US" while running the website from both IIS and Visual Studio's web server. But I get a different date format as follows, when I run the following code: HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.ToString()); HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.DateTimeFormat.ShortDatePattern); On Visual Studio's web server: dd/MM/yyyy en-US On IIS: M/d/yyyy en-US Does "Regional and Language Options" in "Control Panel" play any role in this ? If I change the date format there in "Regional and Language Options", I see no effect in my application.

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

  • How can I put rows of MySQL data under the appropriate titles using PHP?

    - by sfarbota
    I have the following MySQL table structure: num field company phone website 1 Gas abcd 123456789 abcd.com 2 Water efgh 987654321 efgh.com 3 Water ijkl 321654987 ijkl.com 4 Heat mnop 987654321 mnop.com 5 Gas qrst 123789654 qrst.com ... Is it possible with PHP (maybe using some mixture of GROUP_BY and ORDER_BY) to echo the data to the screen in the following format: Gas: abcd qrst 123456789 123789654 abcd.com qrst.com Water: efgh ijkl 987654321 321654987 efgh.com ijkl.com Heat: mnop 321654987 mnop.com The exact format of it isn't important. I just need for the different rows of data to be listed under the appropriate field with none of the fields repeated. I've been trying to figure this out for a while now, but I'm new to PHP and I can't seem to figure out how to do this, if it's even possible, or if there's a better way to organize my data to make it easier.

    Read the article

  • Parsing language for both binary and character files

    - by Thorsten S.
    The problem: You have some data and your program needs specified input. For example strings which are numbers. You are searching for a way to transform the original data in a format you need. And the problem is: The source can be anything. It can be XML, property lists, binary which contains the needed data deeply embedded in binary junk. And your output format may vary also: It can be number strings, float, doubles.... You don't want to program. You want routines which gives you commands capable to transform the data in a form you wish. Surely it contains regular expressions, but it is very good designed and it offers capabilities which are sometimes much more easier and more powerful. Something like a super-grep which you can access (!) as program routines, not only as tool. It allows: joining/grouping/merging of results inserting/deleting/finding/replacing write macros which allows to execute a command chain repeatedly meta-grouping (lists-tables-hypertables) Example (No, I am not looking for a solution to this, it is just an example): You want to read xml strings embedded in a binary file with variable length records. Your tool reads the record length and deletes the junk surrounding your text. Now it splits open the xml and extracts the strings. Being Indian number glyphs and containing decimal commas instead of decimal points, your tool transforms it into ASCII and replaces commas with points. Now the results must be stored into matrices of variable length....etc. etc. I am searching for a good language / language-design and if possible, an implementation. Which design do you like or even, if it does not fulfill the conditions, wouldn't you want to miss ? EDIT: The question is if a solution for the problem exists and if yes, which implementations are available. You DO NOT implement your own sorting algorithm if Quicksort, Mergesort and Heapsort is available. You DO NOT invent your own text parsing method if you have regular expressions. You DO NOT invent your own 3D language for graphics if OpenGL/Direct3D is available. There are existing solutions or at least papers describing the problem and giving suggestions. And there are people who may have worked and experienced such problems and who can give ideas and suggestions. The idea that this problem is totally new and I should work out and implement it myself without background knowledge seems for me, I must admit, totally off the mark.

    Read the article

  • Documentation of a software project

    - by anijhaw
    I am working with a team that works on a very large software project, we have tons of Documentation that is written in MS WORD format with nohyperlinked indexes, no search ability. Everyday we waste our time trying to find the exact document or reference. I was thinking if there was way or even a professional tool that would convert all this into a wiki format and maybe with a little manual (painful) help be organised into something that improves the accessibility. I use Google Desktop Search to make my life a little easier but its not the best solution I just want to know if any of you faced similar problems and possible solutions to this issue.

    Read the article

< Previous Page | 160 161 162 163 164 165 166 167 168 169 170 171  | Next Page >