Search Results

Search found 13757 results on 551 pages for 'decimal format'.

Page 165/551 | < Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

  • symfony sfValidatorSchemaCompare and dateformat output problem

    - by Gerbrand
    public function configure() { $this->widgetSchema['start_date'] = new sfWidgetFormInput(); $this->widgetSchema['end_date'] = new sfWidgetFormInput(); $this->validatorSchema->setPostValidator( new sfValidatorOr ( array( new sfValidatorAnd( array (new sfValidatorSchemaCompare('start_date', sfValidatorSchemaCompare::NOT_EQUAL, null), new sfValidatorSchemaCompare('end_date', sfValidatorSchemaCompare::EQUAL, null) )), new sfValidatorSchemaCompare('start_date', sfValidatorSchemaCompare::LESS_THAN_EQUAL, 'end_date', array('throw_global_error' => false), array('invalid' => 'The start date ("%left_field%") must be before the end date ("%right_field%")'))))); } I've got following input dates which I want to check if the end date isn't before the start date: Input: Start = 31/03/10 End= 07/03/10 Output: The start date (2010-03-31) must be before the end date (2010-03-07) Can you in some way change the date output? I need the error message to set the date format the same as the input. Also my input fields are set with the wrong date format when the error appears. Tried several things, but no luck at this moment. Didn't find a solution or information on symfony it self. I'm using symfony version 1.2.11

    Read the article

  • Parsing language for both binary and character files

    - by Thorsten S.
    The problem: You have some data and your program needs specified input. For example strings which are numbers. You are searching for a way to transform the original data in a format you need. And the problem is: The source can be anything. It can be XML, property lists, binary which contains the needed data deeply embedded in binary junk. And your output format may vary also: It can be number strings, float, doubles.... You don't want to program. You want routines which gives you commands capable to transform the data in a form you wish. Surely it contains regular expressions, but it is very good designed and it offers capabilities which are sometimes much more easier and more powerful. Something like a super-grep which you can access (!) as program routines, not only as tool. It allows: joining/grouping/merging of results inserting/deleting/finding/replacing write macros which allows to execute a command chain repeatedly meta-grouping (lists-tables-hypertables) Example (No, I am not looking for a solution to this, it is just an example): You want to read xml strings embedded in a binary file with variable length records. Your tool reads the record length and deletes the junk surrounding your text. Now it splits open the xml and extracts the strings. Being Indian number glyphs and containing decimal commas instead of decimal points, your tool transforms it into ASCII and replaces commas with points. Now the results must be stored into matrices of variable length....etc. etc. I am searching for a good language / language-design and if possible, an implementation. Which design do you like or even, if it does not fulfill the conditions, wouldn't you want to miss ? EDIT: The question is if a solution for the problem exists and if yes, which implementations are available. You DO NOT implement your own sorting algorithm if Quicksort, Mergesort and Heapsort is available. You DO NOT invent your own text parsing method if you have regular expressions. You DO NOT invent your own 3D language for graphics if OpenGL/Direct3D is available. There are existing solutions or at least papers describing the problem and giving suggestions. And there are people who may have worked and experienced such problems and who can give ideas and suggestions. The idea that this problem is totally new and I should work out and implement it myself without background knowledge seems for me, I must admit, totally off the mark.

    Read the article

  • iPhone OpenGLES textures - colour banding

    - by chicknstu
    I've got a problem with openGL on iPhone which I'm sure must have a simple solution! When I load a texture and display it, I get a lot of what I believe is called 'Colour Banding', whereby the colours, particularly on gradients, seem to get automatically 'optimized'. Just to demonstrate that this wasn't anything wrong with my own code, I downloaded the iPhone 'Crashlanding' app and replaced the background image, and as you can see in the image below (Taken from the simulator), the exact same thing happens. The image on the left is the original PNG, and on the right is it in the game. It's almost as if it's palette is being downsized to a 256 colour one. Screenshot I'm sure this is related to the format I'm saving the image as, although it doesn't just happen with PNG's, it seems to happen no matter what image format I chose. Doing my head in! If you want to recreate this, simply download the crash landing app, and replace the background. Thanks so much in advance for any help.

    Read the article

  • The dictionary need to add every word in SpellingMistakes and the line number but it only adds the l

    - by Will Boomsight
    modules import sys import string Importing and reading the files form the Command Prompt Document = open(sys.argv[1],"r") Document = open('Wc.txt', 'r') Document = Document.read().lower() Dictionary = open(sys.argv[2],"r") Dictionary = open('Dict.txt', 'r') Dictionary = Dictionary.read() def Format(Infile): for ch in string.punctuation: Infile = Infile.replace(ch, "") for no in string.digits: Infile = Infile.replace(no, " ") Infile = Infile.lower() return(Infile) def Corrections(Infile, DictWords): Misspelled = set([]) Infile = Infile.split() DictWords = DictWords.splitlines() for word in Infile: if word not in DictWords: Misspelled.add(word) Misspelled = sorted(Misspelled) return (Misspelled) def Linecheck(Infile,ErrorWords): Infile = Infile.split() lineno = 0 Noset = list() for line in Infile: lineno += 1 line = line.split() for word in line: if word == ErrorWords: Noset.append(lineno) sorted(Noset) return(Noset) def addkey(error,linenum): Nodict = {} for line in linenum: Nodict.setdefault(error,[]).append(linenum) return Nodict FormatDoc = Format(Document) SpellingMistakes = Corrections(FormatDoc,Dictionary) alp = str(SpellingMistakes) for word in SpellingMistakes: nSet = str(Linecheck(FormatDoc,word)) nSet = nSet.split() linelist = addkey(word, nSet) print(linelist) # # for word in Nodict.keys(): # Nodict[word].append(line) Prints each incorrect word on a new line

    Read the article

  • Int128 in .Net?

    - by Adam Tegen
    I need to do some large integer math. Are there any classes or structs out there that represent a 128-bit integer and implement all of the usual operators? BTW, I realize that decimal can be used to represent a 96-bit int.

    Read the article

  • Convert Date to Datetime field.

    - by infant programmer
    The argument my C# function is getting is a string which is merely a Date or a DateTime. I am suppose to convert this String to DateTime, to carry on furthure calculation. Now I need to test whether the incoming data is a Date, if it is date(examle:"12/31/2009"), then I need to add "00:00:00" (24 hours format) to it, so that it will become "12/31/2009 00:00:00". If string manipulation is one possible way, I want to confirm whether there is some other way where we can automate the testing and conversion within DateTime.TryParseExact() method. This is my sample C# code : (which is now only able to convert string of format "MM/dd/yyyy HH:mm:ss" to DateTime.) private static string[] formats = new string[] { "MM/dd/yyyy HH:mm:ss" }; public string date_conv(string date_str) { DateTime date_value; DateTime.TryParseExact(date_str, formats, new global::System.Globalization.CultureInfo("en-US"), global::System.Globalization.DateTimeStyles.None, out date_value); /*Some useful instruction to use date_value*/ return(date_value.ToString("MM/dd/yyyy HH:mm:ss")); }

    Read the article

  • rails convert string to number

    - by Yang
    hi guys, i am wondering is there a convenient function in rails to convert string with negative signs into a number. e.g. -1005.32 when i use to_f method, the number will simply become 1005 with the negative sign and decimal part being ignored. thanks in advance!

    Read the article

  • Refreshing a binding that uses a value converter

    - by Hadi Eskandari
    I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

    Read the article

  • PHP Fomatting Regex - BBCode

    - by Wayne
    To be honest, I suck at regex so much, I would use RegexBuddy, but I'm working on my Mac and sometimes it doesn't help much (for me). Well, for what I need to do is a function in php function replaceTags($n) { $n = str_replace("[[", "<b>", $n); $n = str_replace("]]", "</b>", $n); } Although this is a bad example in case someone didn't close the tag by using ]] or [[, anyway, could you help with regex of: [[ ]] = Bold format ** ** = Italic format (( )) = h2 heading Those are all I need, thanks :) P.S - Is there any software like RegexBuddy available for Mac (Snow Leopard)?

    Read the article

  • Best practice. Do I save html tags in DB or store the html entity value?

    - by Matt
    Hi Guys, I was wondering about which way i should do the following. I am using the tiny MCE wysiwyg editor which formats the users data with the right html tags. Now, i need to save this data entered into the editor into a database table. Should I encode the html tags to their corresponding entities when inserting into the DB, then when i get the data back from the table, not have the encode it for XSS purposes but I'd still have to use eval for the html tags to format the text. OR Do i save the html tags into the database, then when i get the data back from the database encode the html tags to their entities, but then as the tags will appear to the user, I'd have to use the eval function to actually format the data as it was entered. My thoughts are with the first option, I just wondered on what you guys thought.

    Read the article

  • Loop over a file and write the next line if a condition is met

    - by 111078384259264152964
    Having a hard time fixing this or finding any good hints about it. I'm trying to loop over one file, modify each line slightly, and then loop over a different file. If the line in the second file starts with the line from the first then the following line in the second file should be written to a third file. !/usr/bin/env python with open('ids.txt', 'rU') as f: with open('seqres.txt', 'rU') as g: for id in f: id=id.lower()[0:4]+'_'+id[4] with open(id + '.fasta', 'w') as h: for line in g: if line.startswith(''+ id): h.write(g.next()) All the correct files appear, but they are empty. Yes, I am sure the if has true cases. :-) "seqres.txt" has lines with an ID number in a certain format, each followed by a line with data. The "ids.txt" has lines with the ID numbers of interest in a different format. I want each line of data with an interesting ID number in its own file. Thanks a million to anyone with a little advice!

    Read the article

  • Rails Pretty URL with Decimals

    - by Kevin Sylvestre
    I have a rails application that allows searches using longitude and latitude. I have added a 'pretty' route with: map.connect 'stores/near/:longitude/:latitude', :controller => 'stores', :action => 'index' This works for integer latitude and longitude values (http://localhost:3000/stores/near/-88/49) but fails for decimal values (http://localhost:3000/stores/near/-88.341/49.123) giving: Routing Error No route matches "/stores/near/-88/49.0" with {:method=>:get} Any ideas how to use pretty URLs in rails with decimals?

    Read the article

  • mmap() for large file I/O?

    - by Boatzart
    I'm creating a utility in C++ to be run on Linux which can convert videos to a proprietary format. The video frames are very large (up to 16 megapixels), and we need to be able to seek directly to exact frame numbers, so our file format uses libz to compress each frame individually, and append the compressed data onto a file. Once all frames are finished being written, a journal which includes meta data for each frame (including their file offsets and sizes) is written to the end of the file. I'm currently using ifstream and ofstream to do the file i/o, but I am looking to optimize as much as possible. I've heard that mmap() can increase performance in a lot of cases, and I'm wondering if mine is one of them. Our files will be in the tens to hundreds of gigabytes, and although writing will always be done sequentially, random access reads should be done in constant time. Any thoughts as to whether I should investigate this further, and if so does anyone have any tips for things to look out for? Thanks!

    Read the article

  • How to get JSON back from HTTP POST Request (to another domain)

    - by roman m
    I'm trying to use the API on a website, here's the part of the manual: Authenticated Sessions (taken from here) To create an authenticated session, you need to request an authToken from the '/auth' API resource. URL: http://stage.amee.com/auth (this is not my domain) Method: POST Request format: application/x-www-form-urlencoded Response format: application/xml, application/json Response code: 200 OK Response body: Details of the authenticated user, including API version. Extra data: "authToken" cookie and header, containing the authentication token that should be used for subsequent calls. Parameters: username / password Example Request POST /auth HTTP/1.1 Accept: application/xml Content-Type: application/x-www-form-urlencoded username=my_username&password=my_password Response HTTP/1.1 200 OK Set-Cookie: authToken=1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/Pm...; authToken: 1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/PmEvzkPGp...== Content-Type: application/xml; charset=UTF-8 QUESTION: How do I get that to work? I tried jQuery, but it seems to have problem with XSS. Actual code snippet would be greatly appreciated. p.s. All I was looking for was WebClient class in C#

    Read the article

  • Are there any modern platforms with non-IEEE C/C++ float formats?

    - by Patrick Niedzielski
    Hi all, I am writing a video game, Humm and Strumm, which requires a network component in its game engine. I can deal with differences in endianness easily, but I have hit a wall in attempting to deal with possible float memory formats. I know that modern computers have all a standard integer format, but I have heard that they may not all use the IEEE standard for floating-point integers. Is this true? While certainly I could just output it as a character string into each packet, I would still have to convert to a "well-known format" of each client, regardless of the platform. The standard printf() and atod() would be inadequate. Please note, because this game is a Free/Open Source Software program that will run on GNU/Linux, *BSD, and Microsoft Windows, I cannot use any proprietary solutions, nor any single-platform solutions. Cheers, Patrick

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • API for accessing PHP documentation?

    - by Chad Johnson
    I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

    Read the article

< Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >