system data sqlclient sql - Page 1758

How to share memory buffer across sessions in Django?

- by afriza

I want to have one party (or more) sends a stream of data via HTTP request(s). Other parties will be able to receive the same stream of data in almost real-time. The data stream should be accessible across sessions (according to access control list). How can I do this in Django? If possible I would like to avoid database access and use in memory buffer (along with some synchronization mechanism)

Read the article

How to convert varchar to date in PostgreSQL?

- by chandrasekhar

Hi, I have varchar data type column and date data type column . I have to update varchar column data into date column in PostgreSQL. Is it possible? Thanks. chandu

Read the article

load a pickle file from a zipfile

- by eric.frederich

For some reason I cannot get cPickle.load to work on the file-type object returned by ZipFile.open(). If I call read() on the file-type object returned by ZipFile.open() I can use cPickle.loads though. Example .... import zipfile import cPickle # the data we want to store some_data = {1: 'one', 2: 'two', 3: 'three'} # # create a zipped pickle file # zf = zipfile.ZipFile('zipped_pickle.zip', 'w', zipfile.ZIP_DEFLATED) zf.writestr('data.pkl', cPickle.dumps(some_data)) zf.close() # # cPickle.loads works # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd1 = cPickle.loads(zf.open('data.pkl').read()) zf.close() # # cPickle.load doesn't work # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd2 = cPickle.load(zf.open('data.pkl')) zf.close() Note: I don't want to zip just the pickle file but many files of other types. This is just an example.

Read the article

getjson and servers

- by gheil.apl

Is getJSON only useful for those who control a server? Is there any other alternative for getting data from a file? i tried $.getJSON("good.json", function(data){ out=out+"good.json: "+data + ","; }); where good.json = {"a":"1","b":"2"} and got a result of 'null' for data. These all are valid JSON files, and all give null when used in the above: good.htm assoc.json assoc.js stub.json stub.js test.js test.txt and all get a null result... The above is in an interactive setting at http://jsbin.com/dbJSON/8/edit the output (of null) is to be had by clicking 'output'.

Read the article

Icon for shortcut

- by Jacek

Hi! Could you tell me what is wrong in this code?? Why it doesn't work?? <?xml version="1.0" encoding="utf-8"?> <Icon Id="ikonka" SourceFile="Files\AdministKOB.exe"/> <Directory Id="TARGETDIR" Name="SourceDir"> <Directory Id="DesktopFolder"/> <Directory Id="ProgramMenuFolder">  </Directory> <Directory Id="ProgramFilesFolder"> <Directory Id="INSTALLLOCATION" Name="Administ_KOB">  <Component Id="ProductComponent" Guid="6bd37582-5219-4ae4-a56e-cd1ecd375efa">  <File Id="AdministKOB" Name="AdministKOB.exe" Source="Files\AdministKOB.exe" KeyPath="yes"> <Shortcut Advertise="yes" Id="DesktopShortcut" Directory="DesktopFolder" Name="AdministKOB" WorkingDirectory="INSTALLDIR" Description="Elektroniczna ksiazka budynku" Icon ="ikonka"> </Shortcut> </File>  </Component> <Component Id="ProductComponent_cfg" Guid="6bd37582-5219-4ae4-a56e-cd1ecd375efb"> <File Id="data.cfg" Name="data.cfg" Source="Files\data.cfg" /> </Component> <Component Id="ProductComponent_dll" Guid="6bd37582-5219-4ae4-a56e-cd1ecd375efc"> <File Id="DB.dll" Name="DB.dll" Source="Files\DB.dll" /> </Component> <Directory Id="Data"> <Directory Id="Data_1" Name="Data"> <Component Id="ProductComponent_mdf" DiskId="1" Guid="45B88917-DB08-4C4A-9DE4-D41BCE449BA5"> <File Id="bazaKOB.mdf" Name="bazaKOB.mdf" Source="Files\Data\bazaKOB.mdf" /> </Component> <Component Id="ProductComponent_ldf" DiskId="1" Guid="EFEBF7C5-338C-417C-8F5B-3C3BDE46F8EB"> <File Id="bazaKOB_log.LDF" Name="bazaKOB_log.LDF" Source="Files\Data\bazaKOB_log.LDF" /> </Component> </Directory> </Directory> </Directory> </Directory> </Directory> <Feature Id="ProductFeature" Title="AdministKOB" Level="1">  <ComponentRef Id="ProductComponent" /> <ComponentRef Id="ProductComponent_cfg" /> <ComponentRef Id="ProductComponent_dll" /> <ComponentRef Id="ProductComponent_mdf" /> <ComponentRef Id="ProductComponent_ldf" /> </Feature> <Property Id="WIXUI_INSTALLDIR" Value="INSTALLLOCATION" /> <UIRef Id="WixUI_InstallDir" /> <WixVariable Id="WixUIDialogBmp" Value="background_projectUp.bmp" /> <WixVariable Id="WixUILicenseRtf" Value="license.rtf" /> <UI /> </Product> I get this error and warnings: The extension of Icon 'ikonka' for Shortcut 'DesktopShortcut' is not "exe" or "ico". The Icon will not be displayed correctly. Why?? I give ICO file. The extension of Icon 'ikonka' for Shortcut 'DesktopShortcut' does not match the extension of the Key File for component 'ProductComponent'. Have you any idea?? Thanks for all:) Jacek

Read the article

Problem in loading cities using JSON

- by Saravanan I M

I am using Geonames for loading the cities using JSON. Geonames data i imported into my database. I am using MS SQL 2008 Server. I display a dropdown for country select. Once the user select the country. I am loading all the cities into the autocomplete textbox. I am facing a delay in the getJSON method. Also it seems like executing asynchronous. So before getting all the data my autocompelte is getting filled. Below is my complete script. I think i have some problem in the loop. Please advice me what i am doing wrong in my code. $(document).ready(function () { $("#ShowLoad").hide(); //Hook onto the MakeID list's onchange event $("#Country").change(function () { findcities = []; $("#ShowLoad").show(); $("#HomeTown").unautocomplete(); var url = '<%= Url.Content("~/") %>' + "Location/GetCitiesCountByCountry/" + $("#Country").val(); $.getJSON(url, null, function (data) { var total = data; if (total > 0) { var pageTotal = Math.ceil(total / 1000); var isFilled = false; for (var i = 0; i < pageTotal; i++) { var skip = i == 1 ? 0 : (i * 1000) - 1000; var url = '<%= Url.Content("~/") %>' + "Location/GetCitiesByCountry/" + $("#Country").val() + "?skip=" + skip; //alert(i); $.getJSON(url, null, function (data) { $.each(data.Cities, function (index, optionData) { if ($("#Country").val() == "US") { findcities.push(optionData.asciiname + "," + optionData.admin1_code); } else { findcities.push(optionData.asciiname); } }); if (i == pageTotal) { //alert(findcities); $("#ShowLoad").hide(); $("#HomeTown").focus().autocomplete(findcities); } }); } $("#HomeTown").setOptions({ max: 100000 }); } }); }).change(); });

Read the article

File upload in asp.net mvc using ajax

- by Maxim

Hello! i have a simple html form with two controls: input-text and input-file i need to write an ajax query (using jquery is better) to send data (file and value from text field to mvc acton) i wrote $.ajax({ type: "POST", url: "/controller/acton", enctype: 'multipart/form-data', data: 'text=' + $("#text").val() + '&file=' + $("#file").val() ... and in controller: [HttpPost] public ActionResult StoreItem(FormCollection forms) { foreach (string inputTagName in Request.Files) ... returns null in Request... Thank you

Read the article

Black berry: Getting NULL string for exception message.

- by vikram deshpande

I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread( String textMsg, String mobileNumber ) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+"+ mobilenumber); TextMessage text = (TextMessage) msgConn.newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); }catch (IOCancelledException ioce){ System.out.println("IOCancelledException: " + ioce.getMessage()); }catch(IOException ioe){ System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

Read the article

Ajax jquery async return value

- by Sonny

Hi, how can i make this code to don't pause the browser but still return value. You can rewrite this with new method of course. function get_char_val(merk) { var returnValue = null; $.ajax({ type: "POST", async: false, url: "char_info2.php", data: { name: merk }, dataType: "html", success: function(data) { returnValue = data; } }); return returnValue; } var px= get_char_val('x'); var py= get_char_val('y');

Read the article

Can I load multiple UIViewControllers that each kick off their own NSURLConnections?

- by RexOnRoids

My Rootviewcontroller uses NSURLConnection to get data from a server, and then, based on this data, loads a bunch (like 7) of smaller UIViewControllers that each also use their own NSURLConnection to get some more specific data from the server. But, the problem is, only the RooTViewController is recieving callbacks from: - (void)connectionDidFinishLoading:(NSURLConnection *)theConnection the other UIViewControllers never get callbacks...

Read the article

How can I optimize the import of this dataset in mysql?

- by GeoffreyF67

I've got the following table schema: CREATE TABLE `alexa` ( `id` int(10) unsigned NOT NULL, `rank` int(10) unsigned NOT NULL, `domain` varchar(63) NOT NULL, `domainStatus` varchar(6) DEFAULT NULL, PRIMARY KEY (`rank`), KEY `domain` (`domain`), KEY `id` (`id`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 It takes several minutes to import the data. To me that seems rather slow as we're only talking about a million rows of data. What can I do to optimize the insert of this data? (already using disable keys) G-Man

Read the article

Enable access for assistive device programmatically

- by Dheeraj

Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

Read the article

VB.net Cross-Thread

- by PandaNL

Hello, I have a cmd command that needs to be executed, when the command starts it starts to fill a progressbar. When the cmd command is done the progressbar needs to fill up to 100. This is the code i use, but it gives me an error when the progressbar.Value = 100 comes up. Public Class Form1 Dim teller As Integer Private Sub Timer1_Tick(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles TimerProgressbar.Tick teller += 1 ProgressBar1.Value = teller If ProgressBar1.Value = ProgressBar1.Maximum Then TimerProgressbar.Stop() End If End Sub This are the tow commands in another private sub where the app is crashing on ProgressBar1.Value = 100 TimerProgressbar.Stop() When i debug it and i try it out it crashes on ProgressBar1.Value = 100 But when i build it under Windows 7 it runs fine without crashing, however a few people reported me it crashes on there Windows xp system. VB gives me a suggestions about Cross Thread, but i don't know how i could make it work with this.

Read the article

What should a self-taught programmer with no degree learn/read?

- by sjbotha

I am a self-taught programmer and I do do not have any degrees. I started pretty young and I've got about 7 years of actual programming work experience. I believe I'm a pretty good programmer, but I admit that I have not played much with algorithms or delved into any really low-level aspects of programming such as how compilers work. I have worked with other programmers with and without degrees. Some were good and some not; having a degree didn't seem to make any difference as to which pot they fell into. Since then I've come to realize that it does depend on the school where the degree is obtained. Some people suggest that you really should get a degree; that there are things you'll learn in the process that you won't learn in the real world. Of course there is personal growth and discipline learned from completing a task of that magnitude, but let's just concentrate on the technical knowledge. What would I have been taught in a GOOD CS course that would aid me today and what can I read to fill the gap? I've heard the book "Algorithms" mentioned and I plan on reading that. What other books would you recommend? Edit: Clarification on 'actual work experience': Have worked for 2 small companies on teams with fewer than 5 people. About 2 years experience with Perl, Python, PHP, C, C++. About 5 years experience in Java, Applets, RMI, T-SQL, PL/SQL, VB6. 7 years experience in HTML, Javascript, bash, SQL. Most recently in Java designed and helped build an N-tier Java app with web frontend and RMI.

Read the article

Hang while starting several daemons [solved]

- by Adrian Lang

I’m running a Debian Squeeze AMD64 server. Target runlevel after boot is runlevel 2, which includes rsyslogd, cron, sshd and some other stuff, but not dovecot, postfix, apache2, etc. The system fails to reach runlevel 2 with several symptoms: The system hangs at trying to start rsyslogd Booting into runlevel 1 works, then login from the console works Starting rsyslogd from runlevel 1 via /etc/init.d/rsyslog hangs Starting runlevel 2 with rsyslogd disabled works But then, logging in via console fails: I get the motd, and then nothing Starting sshd from runlevel 1 succeeds But then, I cannot login via ssh. Sometimes password ssh login gives me the motd and then nothing, sometimes not even this. Trying to offer a public key seems to annoy the sshd enough to not talk to me any further. When rebooting from runlevel 1, the server hangs at trying to stop apache2 (which is not running, so this really should be trivial). Trying to stop apache2 when logged in in runleve 1 does hang as well. And that’s just the stuff which fails all the time. RAM has been tested, dmesg shows no problems. I have no clue. Update: (shortened) output from rsyslogd -c4 -d called in runlevel 1 rsyslogd 4.6.4 startup, compatibility mode 4, module path '' caller requested object 'net', not found (iRet -3003) Requested to load module 'lmnet' loading module '/user/lib/rsyslog/lmnet.so' module of type 2 being loaded conf.c requested ref for 'lmnet', refcount 1 rsylog runtime initialized, version 4.6.4, current users 1 syslogd.c requested ref for 'lmnet', refcount now 2 I can kill rsyslogd with Strg+C, then. /var/log shows none of the configured log files, though. Update2: Thanks to @DerfK I still have no clue, but at least I narrowed down the problem. I’m now testing with /etc/init.d/apache2 stop (without an apache2 running, of course) which hangs as well and looks like an even more obvious failure. After some testing I found out that a file with one single line: /usr/sbin/apache2ctl configtest /dev/null 2&1 hangs, while the same line executed in an interactive shell works. I was not able to further reduce this line while, i. e. every single part, the stream redirections and the commando itself is necessary to reproduce the hang. @DerfK also pointed me to strace which gave a shallow hint about what kind of hang we have here: wait4(-1for the init scripts futex(0xsomepointer, FUTEX_WAIT_PRIVATE, 2, NULL for rsyslogd / apache2 binaries called by the init scripts The system was installed as a Debian Lenny by my hoster in autumn 2011, I upgraded it to Squeeze immediately and kept it up to date with Squeeze, which then used to be testing. There were no big changes, though. I guess I never tried to reboot the system before. Update3: I found the problem. My /etc/nsswitch.conf specified ldap as hosts lookup backup, which is not available at that time of the boot. Relying on dns solely fixes my boot problems.

Read the article

help me to my project [closed]

- by latha

hi. plz tel me to how to collect data for my project. as my projct relate to "sustainable urban infrastructure" so help me that what what data should i put to my project.i dont had any idea that how to do vit data analysis .so please direct me .

Read the article

How to handle empty return from getJSON

- by Gee

Alright so I have a php script which gets results from a DB, and to get those results I'm using a jQuery script to pull the results via getJSON. It works perfectly but now I want to do something if the php script returns no results (empty). I tried: $.getJSON('path/to/script'), {parameter:parameter}, function(data){ if (data) { alert('Result'); } else { alert('Empty); } }); But it's no good. I've tried different things like if (data.length) but still nothing. I've noticed that if there is no returned data the callback will never fire at all. So if that's the case, how do I handle a empty return?

Read the article

jQuery server ping slowly but surely filling memory?

- by danspants

I use the following piece of code to test if our server is running whilst the user is in a page. I've also started adding other functions that grab small amounts of data that are constantly changing and are to be relayed to the user (Files waiting for download, messages, reports etc). I've noticed recently that if I leave any page open (all pages contain the same function), the browser takes up more and more system memory which I can only attribute to this regular task (overnight it reached 1.6 gb). Is there some way of clearing out the data that is being accumulated? Is this normal behaviour? As far as i can tell, every time I call the function it should overwrite the previously retrieved data? function testServer(){ jQuery.ajax({ type:"HEAD", url:"/media/d_arrow_blue.png", error: function(msg) { jQuery.jGrowl("Server Disconnected"); } }); //retrieves count of files awaiting download - move to seperate function jQuery.get("/get_files/",{"type":"count"},function(data) { jQuery("#downloadList").children("div").text(data); }); }; jQuery().doTimeout(6000,function() { testServer(); return true; });

Read the article

Interfacing with Compris POS

- by Sargun Dhillon

Does anyone have any data on how to interface with a Compris POS? I have a Compris POS, and I need to grab data from the database. I can't get information from NCR regarding the underlying data format, and I was wondering if anyone had reverse engineered the device, or had any documentation on the device.

Read the article

Java - getClassLoader().getResource() driving me bonkers

- by Click Upvote

I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

Read the article

Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\$",""); b[i][j]=b[i][j].replaceAll("\$",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Read the article

MS Access 2003 - Option Group frame: can I add text boxes that are part of the frame instead of rad

- by Justin

Ok so this maybe a simple/silly question but I don't know so here goes: In access let's say I want to have a frame control, so I click the option group button and add it to the desgin surface. However, I am not wanting to use this as a option group with radio button selection, instead I would like to add text boxes instead the frame, so that when I reference the frame, it references every control instead of it, hence the text boxes, cbo boxes, etc.....just as it would if they were radio option selections. So can you do this? I want whatever controls I add inside the frame to be easily referenced (i.e. make all controls visible just by using frameExample.visible = true) so that I can build my own tab control groupings..... can this be done? Thanks! EDIT: What I am trying to accomplish is having a form that includes a collection of controls (input controls - cbo boxes, text boxes, etc), that serve as the Main record information. These are saved to a table via an INSERT statement on button_click because this form is unbound. Next I have 8 categories that are relative per each main record (and data that goes along with it). Each of these categories could have a sub form area and a button click that bring it's relative form into the sub form area. These sub forms would be unbound as well as I would just save data via SQL statement. So i know I could accomplish this by running the insert statement from the parent form, on the main collection control's data that would create the KeyID number, then run a SQL statement that would turn around and load that KeyID number right back onto the page in a hidden text box. Then when I click one of the sub forms and load its relative collection of controls, I could then save that data along with KeyID for each of these sub-forms/tables. SO...... I was wondering if instead you could define these controls as a collection so that you could hide and make visible all the ones you need on button clicks and avoid the need for additional forms (subs). I know that if a user enters data into a text box, and then somewhere along the way that box becomes hidden, the data still exists in it and still ends up in the SQL statement.... So I want all these controls to exist on the same form, but I thought what is I could encapsulate them into a frame like an option group, then I could call the frame and all the relative controls would be called up (made visible) as needed. Sorry for the long explanation but I thought it would help.

Read the article

C# asynchronous beginsend method

- by Jatin

I am a newbie in socket programming. I am developing a server client application. And I am using Asynchronous tcp ip socket. But now I am facing a problem. In my client side I am receiving my data by a 2kb byte array by beginReceive method. Its working perfectly if data size below or equals to 2 kb, but problem occurring when data size exceeding 2kb range. Please give me some solution.

Read the article

How do I print out objects in an array in python?

- by Jonathan

I'm writing a code which performs a k-means clustering on a set of data. I'm actually using the code from a book called collective intelligence by O'Reilly. Everything works, but in his code he uses the command line and i want to write everything in notepad++. As a reference his line is >>>kclust=clusters.kcluster(data,k=10) >>>[rownames[r] for r in k[0]] Here is my code: from PIL import Image,ImageDraw def readfile(filename): lines=[line for line in file(filename)] # First line is the column titles colnames=lines[0].strip( ).split('\t')[1:] rownames=[] data=[] for line in lines[1:]: p=line.strip( ).split('\t') # First column in each row is the rowname rownames.append(p[0]) # The data for this row is the remainder of the row data.append([float(x) for x in p[1:]]) return rownames,colnames,data from math import sqrt def pearson(v1,v2): # Simple sums sum1=sum(v1) sum2=sum(v2) # Sums of the squares sum1Sq=sum([pow(v,2) for v in v1]) sum2Sq=sum([pow(v,2) for v in v2]) # Sum of the products pSum=sum([v1[i]*v2[i] for i in range(len(v1))]) # Calculate r (Pearson score) num=pSum-(sum1*sum2/len(v1)) den=sqrt((sum1Sq-pow(sum1,2)/len(v1))*(sum2Sq-pow(sum2,2)/len(v1))) if den==0: return 0 return 1.0-num/den class bicluster: def __init__(self,vec,left=None,right=None,distance=0.0,id=None): self.left=left self.right=right self.vec=vec self.id=id self.distance=distance def hcluster(rows,distance=pearson): distances={} currentclustid=-1 # Clusters are initially just the rows clust=[bicluster(rows[i],id=i) for i in range(len(rows))] while len(clust)>1: lowestpair=(0,1) closest=distance(clust[0].vec,clust[1].vec) # loop through every pair looking for the smallest distance for i in range(len(clust)): for j in range(i+1,len(clust)): # distances is the cache of distance calculations if (clust[i].id,clust[j].id) not in distances: distances[(clust[i].id,clust[j].id)]=distance(clust[i].vec,clust[j].vec) #print 'i' #print i #print #print 'j' #print j #print d=distances[(clust[i].id,clust[j].id)] if d<closest: closest=d lowestpair=(i,j) # calculate the average of the two clusters mergevec=[ (clust[lowestpair[0]].vec[i]+clust[lowestpair[1]].vec[i])/2.0 for i in range(len(clust[0].vec))] # create the new cluster newcluster=bicluster(mergevec,left=clust[lowestpair[0]], right=clust[lowestpair[1]], distance=closest,id=currentclustid) # cluster ids that weren't in the original set are negative currentclustid-=1 del clust[lowestpair[1]] del clust[lowestpair[0]] clust.append(newcluster) return clust[0] def kcluster(rows,distance=pearson,k=4): # Determine the minimum and maximum values for each point ranges=[(min([row[i] for row in rows]),max([row[i] for row in rows])) for i in range(len(rows[0]))] # Create k randomly placed centroids clusters=[[random.random( )*(ranges[i][1]-ranges[i][0])+ranges[i][0] for i in range(len(rows[0]))] for j in range(k)] lastmatches=None for t in range(100): print 'Iteration %d' % t bestmatches=[[] for i in range(k)] # Find which centroid is the closest for each row for j in range(len(rows)): row=rows[j] bestmatch=0 for i in range(k): d=distance(clusters[i],row) if d<distance(clusters[bestmatch],row): bestmatch=i bestmatches[bestmatch].append(j) # If the results are the same as last time, this is complete if bestmatches==lastmatches: break lastmatches=bestmatches # Move the centroids to the average of their members for i in range(k): avgs=[0.0]*len(rows[0]) if len(bestmatches[i])>0: for rowid in bestmatches[i]: for m in range(len(rows[rowid])): avgs[m]+=rows[rowid][m] for j in range(len(avgs)): avgs[j]/=len(bestmatches[i]) clusters[i]=avgs return bestmatches

Read the article

Initialization vector - DES/triple-des algorithm

- by user312373

Hi, In order to generate the encrypted data we would need to define a Key that should suffice generating the data. But in .net DESCryptoServiceProvider requires Key and Intialisation Vector to generate the encrypted data. In this regard, I would like to know the importance & the benefit gained by defining this initialisation vector field. Is this mandatory while encryption using DES algorithm. Pls share your thoughts on the same. Regards, Balu

Search Results

Search found 111053 results on 4443 pages for 'system data sqlclient sql'.

Page 1758/4443 | < Previous Page | 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 | Next Page >

- by afriza

- by chandrasekhar

- by eric.frederich

- by gheil.apl

- by Jacek

- by Saravanan I M

- by Maxim

- by vikram deshpande

- by Sonny

- by RexOnRoids

- by GeoffreyF67

- by Dheeraj

- by PandaNL

- by sjbotha

- by Adrian Lang

- by latha

- by Gee

- by danspants

- by Sargun Dhillon

- by Click Upvote

- by Vijay Kumar Singh

- by Justin

- by Jatin

- by Jonathan

- by user312373

< Previous Page | 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 | Next Page >