Search Results

Search found 5919 results on 237 pages for 'regex matching'.

Page 234/237 | < Previous Page | 230 231 232 233 234 235 236 237  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to match ColdFusion encryption with Java 1.4.2?

    - by JohnTheBarber
    * sweet - thanks to Edward Smith for the CF Technote that indicated the key from ColdFusion was Base64 encoded. See generateKey() for the 'fix' My task is to use Java 1.4.2 to match the results a given ColdFusion code sample for encryption. Known/given values: A 24-byte key A 16-byte salt (IVorSalt) Encoding is Hex Encryption algorithm is AES/CBC/PKCS5Padding A sample clear-text value The encrypted value of the sample clear-text after going through the ColdFusion code Assumptions: Number of iterations not specified in the ColdFusion code so I assume only one iteration 24-byte key so I assume 192-bit encryption Given/working ColdFusion encryption code sample: <cfset ThisSalt = "16byte-salt-here"> <cfset ThisAlgorithm = "AES/CBC/PKCS5Padding"> <cfset ThisKey = "a-24byte-key-string-here"> <cfset thisAdjustedNow = now()> <cfset ThisDateTimeVar = DateFormat( thisAdjustedNow , "yyyymmdd" )> <cfset ThisDateTimeVar = ThisDateTimeVar & TimeFormat( thisAdjustedNow , "HHmmss" )> <cfset ThisTAID = ThisDateTimeVar & "|" & someOtherData> <cfset ThisTAIDEnc = Encrypt( ThisTAID , ThisKey , ThisAlgorithm , "Hex" , ThisSalt)> My Java 1.4.2 encryption/decryption code swag: package so.example; import java.security.*; import javax.crypto.Cipher; import javax.crypto.spec.IvParameterSpec; import javax.crypto.spec.SecretKeySpec; import org.apache.commons.codec.binary.*; public class SO_AES192 { private static final String _AES = "AES"; private static final String _AES_CBC_PKCS5Padding = "AES/CBC/PKCS5Padding"; private static final String KEY_VALUE = "a-24byte-key-string-here"; private static final String SALT_VALUE = "16byte-salt-here"; private static final int ITERATIONS = 1; private static IvParameterSpec ivParameterSpec; public static String encryptHex(String value) throws Exception { Key key = generateKey(); Cipher c = Cipher.getInstance(_AES_CBC_PKCS5Padding); ivParameterSpec = new IvParameterSpec(SALT_VALUE.getBytes()); c.init(Cipher.ENCRYPT_MODE, key, ivParameterSpec); String valueToEncrypt = null; String eValue = value; for (int i = 0; i < ITERATIONS; i++) { // valueToEncrypt = SALT_VALUE + eValue; // pre-pend salt - Length > sample length valueToEncrypt = eValue; // don't pre-pend salt Length = sample length byte[] encValue = c.doFinal(valueToEncrypt.getBytes()); eValue = Hex.encodeHexString(encValue); } return eValue; } public static String decryptHex(String value) throws Exception { Key key = generateKey(); Cipher c = Cipher.getInstance(_AES_CBC_PKCS5Padding); ivParameterSpec = new IvParameterSpec(SALT_VALUE.getBytes()); c.init(Cipher.DECRYPT_MODE, key, ivParameterSpec); String dValue = null; char[] valueToDecrypt = value.toCharArray(); for (int i = 0; i < ITERATIONS; i++) { byte[] decordedValue = Hex.decodeHex(valueToDecrypt); byte[] decValue = c.doFinal(decordedValue); // dValue = new String(decValue).substring(SALT_VALUE.length()); // when salt is pre-pended dValue = new String(decValue); // when salt is not pre-pended valueToDecrypt = dValue.toCharArray(); } return dValue; } private static Key generateKey() throws Exception { // Key key = new SecretKeySpec(KEY_VALUE.getBytes(), _AES); // this was wrong Key key = new SecretKeySpec(new BASE64Decoder().decodeBuffer(keyValueString), _AES); // had to un-Base64 the 'known' 24-byte key. return key; } } I cannot create a matching encrypted value nor decrypt a given encrypted value. My guess is it's something to do with how I'm handling the initial vector/salt. I'm not very crypto-savvy but I'm thinking I should be able to take the sample clear-text and produce the same encrypted value in Java as ColdFusion produced. I am able to encrypt/decrypt my own data with my Java code (so I'm consistent) but I cannot match nor decrypt the ColdFusion sample encrypted value. I have access to a local webservice that can test the encrypted output. The given ColdFusion output sample passes/decrypts fine (of course). If I try to decrypt the same sample with my Java code (using the actual key and salt) I get a "Given final block not properly padded" error. I get the same net result when I pass my attempt at encryption (using the actual key and salt) to the test webservice. Any Ideas?

    Read the article

  • Why wont this sort in Solr work?

    - by Camran
    I need to sort on a date-field type, which name is "mod_date". It works like this in the browser adress-bar: http://localhost:8983/solr/select/?&q=bmw&sort=mod_date+desc But I am using a phpSolr client which sends an URL to Solr, and the url sent is this: fq=+category%3A%22Bilar%22+%2B+car_action%3AS%C3%A4ljes&version=1.2&wt=json&json.nl=map&q=%2A%3A%2A&start=0&rows=5&sort=mod_date+desc // This wont work and is echoed after this in php: $queryString = http_build_query($params, null, $this->_queryStringDelimiter); $queryString = preg_replace('/%5B(?:[0-9]|[1-9][0-9]+)%5D=/', '=', $queryString); This wont work, I dont know why! Everything else works fine, all right fields are returned. But the sort doesn't work. Any ideas? Thanks BTW: The field "mod_date" contains something like: 2010-03-04T19:37:22.5Z EDIT: First I use PHP to send this to a SolrPhpClient which is another php-file called service.php: require_once('../SolrPhpClient/Apache/Solr/Service.php'); $solr = new Apache_Solr_Service('localhost', 8983, '/solr/'); $results = $solr->search($querystring, $p, $limit, $solr_params); $solr_params is an array which contains the solr-parameters (q, fq, etc). Now, in service.php: $params['version'] = self::SOLR_VERSION; // common parameters in this interface $params['wt'] = self::SOLR_WRITER; $params['json.nl'] = $this->_namedListTreatment; $params['q'] = $query; $params['sort'] = 'mod_date desc'; // HERE IS THE SORT I HAVE PROBLEM WITH $params['start'] = $offset; $params['rows'] = $limit; $queryString = http_build_query($params, null, $this->_queryStringDelimiter); $queryString = preg_replace('/%5B(?:[0-9]|[1-9][0-9]+)%5D=/', '=', $queryString); if ($method == self::METHOD_GET) { return $this->_sendRawGet($this->_searchUrl . $this->_queryDelimiter . $queryString); } else if ($method == self::METHOD_POST) { return $this->_sendRawPost($this->_searchUrl, $queryString, FALSE, 'application/x-www-form-urlencoded'); } The $results contain the results from Solr... So this is the way I need to get to work (via php). This code below (also on top of this Q) works but thats because I paste it into the adress bar manually, not via the PHPclient. But thats just for debugging, I need to get it to work via the PHPclient: http://localhost:8983/solr/select/?&q=bmw&sort=mod_date+des // Not via phpclient, but works UPDATE (2010-03-08): I have tried Donovans codes (the urls) and they work fine. Now, I have noticed that it is one of the parameters causing the 'SORT' not to work. This parameter is the "wt" parameter. If we take the url from top of this Q, (fq=+category%3A%22Bilar%22+%2B+car_action%3AS%C3%A4ljes&version=1.2&wt=json&json.nl=map&q=%2A%3A%2A&start=0&rows=5&sort=mod_date+desc), and just simply remove the "wt" parameter, then the sort works. BUT the results appear differently, thus making my php code not able to recognize the results I believe. Donovan would know this I think. I am guessing in order for the PHPClient to work, the results must be in a specific structure, which gets messed up as soon as I remove the wt parameter. Donovan, help me please... Here is some background what I use your SolrPhpClient for: I have a classifieds website, which uses MySql. But for the searching I am using Solr to search some indexed fields. Then Solr returns an array of ID:numbers (for all matches of the search criteria). Then I use those ID:numbers to find everything in a MySql db and fetch all other information (example is not searchable information). So simplified: Search - Solr returns all matches in an array of ID:nrs - Id:numbers from Solr are the same as the Id numbers in the MySql db, so I can just make a simple match agains every record with the ID matching the ID from the Solr results array. I don't use Faceting, no boosting, no relevancy or other fancy stuff. I only sort by the latest classified put, and give the option to users to also sort on the cheapest price. Nothing more. Then I use the "fq" parameter to do queries on different fields in Solr depending on category chosen by users (example "cars" in this case which in my language is "Bilar"). I am really stuck with this problem here... Thanks for all help

    Read the article

  • creating a color coded time chart using colorbar and colormaps in python

    - by Rusty
    I'm trying to make a time tracking chart based on a daily time tracking file that I used. I wrote code that crawls through my files and generates a few lists. endTimes is a list of times that a particular activity ends in minutes going from 0 at midnight the first day of the month to however many minutes are in a month. labels is a list of labels for the times listed in endTimes. It is one shorter than endtimes since the trackers don't have any data about before 0 minute. Most labels are repeats. categories contains every unique value of labels in order of how well I regard that time. I want to create a colorbar or a stack of colorbars (1 for eachday) that will depict how I spend my time for a month and put a color associated with each label. Each value in categories will have a color associated. More blue for more good. More red for more bad. It is already in order for the jet colormap to be right, but I need to get desecrate color values evenly spaced out for each value in categories. Then I figure the next step would be to convert that to a listed colormap to use for the colorbar based on how the labels associated with the categories. I think this is the right way to do it, but I am not sure. I am not sure how to associate the labels with color values. Here is the last part of my code so far. I found one function to make a discrete colormaps. It does, but it isn't what I am looking for and I am not sure what is happening. Thanks for the help! # now I need to develop the graph import numpy as np from matplotlib import pyplot,mpl import matplotlib from scipy import interpolate from scipy import * def contains(thelist,name): # checks if the current list of categories contains the one just read for val in thelist: if val == name: return True return False def getCategories(lastFile): ''' must determine the colors to use I would like to make a gradient so that the better the task, the closer to blue bad labels will recieve colors closer to blue read the last file given for the information on how I feel the order should be then just keep them in the order of how good they are in the tracker use a color range and develop discrete values for each category by evenly spacing them out any time not found should assume to be sleep sleep should be white ''' tracker = open(lastFile+'.txt') # open the last file # find all the categories categories = [] for line in tracker: pos = line.find(':') # does it have a : or a ? if pos==-1: pos=line.find('?') if pos != -1: # ignore if no : or ? name = line[0:pos].strip() # split at the : or ? if contains(categories,name)==False: # if the category is new categories.append(name) # make a new one return categories # find good values in order of last day newlabels=[] for val in getCategories(lastDay): if contains(labels,val): newlabels.append(val) categories=newlabels # convert discrete colormap to listed colormap python for ii,val in enumerate(labels): if contains(categories,val)==False: labels[ii]='sleep' # create a figure fig = pyplot.figure() axes = [] for x in range(endTimes[-1]%(24*60)): ax = fig.add_axes([0.05, 0.65, 0.9, 0.15]) axes.append(ax) # figure out the colors to use # stole this function to make a discrete colormap # http://www.scipy.org/Cookbook/Matplotlib/ColormapTransformations def cmap_discretize(cmap, N): """Return a discrete colormap from the continuous colormap cmap. cmap: colormap instance, eg. cm.jet. N: Number of colors. Example x = resize(arange(100), (5,100)) djet = cmap_discretize(cm.jet, 5) imshow(x, cmap=djet) """ cdict = cmap._segmentdata.copy() # N colors colors_i = np.linspace(0,1.,N) # N+1 indices indices = np.linspace(0,1.,N+1) for key in ('red','green','blue'): # Find the N colors D = np.array(cdict[key]) I = interpolate.interp1d(D[:,0], D[:,1]) colors = I(colors_i) # Place these colors at the correct indices. A = zeros((N+1,3), float) A[:,0] = indices A[1:,1] = colors A[:-1,2] = colors # Create a tuple for the dictionary. L = [] for l in A: L.append(tuple(l)) cdict[key] = tuple(L) # Return colormap object. return matplotlib.colors.LinearSegmentedColormap('colormap',cdict,1024) # jet colormap goes from blue to red (good to bad) cmap = cmap_discretize(mpl.cm.jet, len(categories)) cmap.set_over('0.25') cmap.set_under('0.75') #norm = mpl.colors.Normalize(endTimes,cmap.N) print endTimes print labels # make a color list by matching labels to a picture #norm = mpl.colors.ListedColormap(colorList) cb1 = mpl.colorbar.ColorbarBase(axes[0],cmap=cmap ,orientation='horizontal' ,boundaries=endTimes ,ticks=endTimes ,spacing='proportional') pyplot.show()

    Read the article

  • Compile error with initializer_list when trying to use it to initialize member value of class

    - by ilektron
    I am trying to make a class initializable from an initialization_list in a class constructor's constructor's initialization list. It works for a std::map, but not for my custom class. I don't see any difference other than templates are used in std::map. #include <iostream> #include <initializer_list> #include <string> #include <sstream> #include <map> using std::string; class text_thing { private: string m_text; public: text_thing() { } text_thing(text_thing& other); text_thing(std::initializer_list< std::pair<const string, const string> >& il); text_thing& operator=(std::initializer_list< std::pair<const string, const string> >& il); operator string() { return m_text; } }; class static_base { private: std::map<string, string> m_test_map; text_thing m_thing; static_base(); public: static static_base& getInstance() { static static_base instance; return instance; } string getText() { return (string)m_thing; } }; typedef std::pair<const string, const string> spair; text_thing::text_thing(text_thing& other) { m_text = other.m_text; } text_thing::text_thing(std::initializer_list< std::pair<const string, const string> >& il) { std::stringstream text_gen; for (auto& apair : il) { text_gen << "{" << apair.first << ", " << apair.second << "}" << std::endl; } } text_thing& text_thing::operator=(std::initializer_list< std::pair<const string, const string> >& il) { std::stringstream text_gen; for (auto& apair : il) { text_gen << "{" << apair.first << ", " << apair.second << "}" << std::endl; } return *this; } static_base::static_base() : m_test_map{{"test", "1"}, {"test2", "2"}}, // Compiler fine with this m_thing{{"test", "1"}, {"test2", "2"}} // Compiler doesn't like this { } int main() { std::cout << "Starting the program" << std::endl; std::cout << "The text thing: " << std::endl << static_base::getInstance().getText(); } I get this compiler output g++ -O0 -g3 -Wall -c -fmessage-length=0 -std=c++11 -MMD -MP -MF"static_base.d" -MT"static_base.d" -o "static_base.o" "../static_base.cpp" Finished building: ../static_base.cpp Building file: ../test.cpp Invoking: GCC C++ Compiler g++ -O0 -g3 -Wall -c -fmessage-length=0 -std=c++11 -MMD -MP -MF"test.d" -MT"test.d" -o "test.o" "../test.cpp" ../test.cpp: In constructor ‘static_base::static_base()’: ../test.cpp:94:40: error: no matching function for call to ‘text_thing::text_thing(<brace-enclosed initializer list>)’ m_thing{{"test", "1"}, {"test2", "2"}} ^ ../test.cpp:94:40: note: candidates are: ../test.cpp:72:1: note: text_thing::text_thing(std::initializer_list<std::pair<const std::basic_string<char>, const std::basic_string<char> > >&) text_thing::text_thing(std::initializer_list< std::pair<const string, const string> >& il) ^ ../test.cpp:72:1: note: candidate expects 1 argument, 2 provided ../test.cpp:67:1: note: text_thing::text_thing(text_thing&) text_thing::text_thing(text_thing& other) ^ ../test.cpp:67:1: note: candidate expects 1 argument, 2 provided ../test.cpp:23:2: note: text_thing::text_thing() text_thing() ^ ../test.cpp:23:2: note: candidate expects 0 arguments, 2 provided make: *** [test.o] Error 1 Output of gcc -v Using built-in specs. COLLECT_GCC=gcc COLLECT_LTO_WRAPPER=/usr/lib/gcc/x86_64-linux-gnu/4.8/lto-wrapper Target: x86_64-linux-gnu Configured with: ../src/configure -v --with-pkgversion='Ubuntu 4.8.1-2ubuntu1~13.04' --with-bugurl=file:///usr/share/doc/gcc-4.8/README.Bugs --enable-languages=c,c++,java,go,d,fortran,objc,obj-c++ --prefix=/usr --program-suffix=-4.8 --enable-shared --enable-linker-build-id --libexecdir=/usr/lib --without-included-gettext --enable-threads=posix --with-gxx-include-dir=/usr/include/c++/4.8 --libdir=/usr/lib --enable-nls --with-sysroot=/ --enable-clocale=gnu --enable-libstdcxx-debug --enable-libstdcxx-time=yes --enable-gnu-unique-object --enable-plugin --with-system-zlib --disable-browser-plugin --enable-java-awt=gtk --enable-gtk-cairo --with-java-home=/usr/lib/jvm/java-1.5.0-gcj-4.8-amd64/jre --enable-java-home --with-jvm-root-dir=/usr/lib/jvm/java-1.5.0-gcj-4.8-amd64 --with-jvm-jar-dir=/usr/lib/jvm-exports/java-1.5.0-gcj-4.8-amd64 --with-arch-directory=amd64 --with-ecj-jar=/usr/share/java/eclipse-ecj.jar --enable-objc-gc --enable-multiarch --disable-werror --with-arch-32=i686 --with-abi=m64 --with-multilib-list=m32,m64,mx32 --with-tune=generic --enable-checking=release --build=x86_64-linux-gnu --host=x86_64-linux-gnu --target=x86_64-linux-gnu Thread model: posix gcc version 4.8.1 (Ubuntu 4.8.1-2ubuntu1~13.04) It compiles fine with the std::map constructed this way, and if I modify the static_base to return the strings from the maps, all is fine and dandy. Please help me understand what is going on here.

    Read the article

  • Service injection into Controller (Spring MVC)

    - by ThaSaleni
    Hi I have a Spring web application, I have built it up to the controller stage and I could inject my Daos, into my Services fine. Now when I want to inject my Service into my controller i get an error for dependency with the Dao and further down the sessionFactory. I don't want to inject these again cause this will ultimately lead me to eventually create a data source but I have my Daos for data access and they already know about sessionFactory. Am I missing something here? here's the sample code snippets My Service: @Service("productService") @Transactional public class ProductServiceImpl implements ProductService { private ProductDao productDao; @Autowired public void setDao(ProductDao productDao) { this.productDao = productDao; } My Controller @Controller @WebServlet(name="controllerServlet", loadOnStartup= urlPatterns=...}) public class ControllerServlet extends HttpServlet { boolean isUserLogedIn =false; @Autowired private ProductService productService; public void setProductService(ProductService productService){ this.productService = productService; } Servlet-context Stack trace javax.servlet.ServletException: Servlet.init() for servlet mvcServlet threw exception org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:472) org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:98) org.apache.catalina.valves.AccessLogValve.invoke(AccessLogValve.java:927) org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:407) org.apache.coyote.http11.AbstractHttp11Processor.process(AbstractHttp11Processor.java:999) org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java: 565) org.apache.tomcat.util.net.AprEndpoint$SocketProcessor.run(AprEndpoint.java:1812) java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) java.lang.Thread.run(Thread.java:662) root cause org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'controllerServlet': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: private com.phumzile.acme.services.ProductService com.phumzile.acme.client.web.controller.ControllerServlet.productService; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No matching bean of type [com.phumzile.acme.services.ProductService] found for dependency: expected at least 1 bean which qualifies as autowire candidate for this dependency. Dependency annotations: {@org.springframework.beans.factory.annotation.Autowired(required=true)} org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor.p ostProcessPropertyValues(AutowiredAnnotationBeanPostProcessor.java:287) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1106) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:294) org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:225) SERVLET-CONTEXT <context:component-scan base-package="com.phumzile.acme.client" /> <!-- Enables the Spring MVC @Controller programming model --> <mvc:annotation-driven /> </beans> APP-CONFIG <bean id="propertyConfigurer" class="org.springframework.beans.factory.config.PropertyPlaceholderConfigurer"> <property name="locations"> <list> <value>configuration.properties</value> </list> </property> </bean> <context:annotation-config/> <context:component-scan base-package="com.phumzile.acme" /> <import resource="db-config.xml" /> </beans> DB-CONFIG <bean id="dataSource" class="com.mchange.v2.c3p0.ComboPooledDataSource" destroy-method="close"> <property name="idleConnectionTestPeriod" value="10800"/> <property name="maxIdleTime" value="21600"/> <property name="driverClass"> <value>${jdbc.driver.className}</value> </property> <property name="jdbcUrl"> <value>${jdbc.url}</value> </property> <property name="user"> <value>${jdbc.username}</value> </property> <property name="password"> <value>${jdbc.password}</value> </property> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.a nnotation.AnnotationSessionFactoryBean"> <property name="dataSource"> <ref bean="dataSource" /> </property> <property name="annotatedClasses"> <list> <!-- Entities --> <value>com.phumzile.acme.model.User</value> <value>com.phumzile.acme.model.Person</value> <value>com.phumzile.acme.model.Company</value> <value>com.phumzile.acme.model.Product</value> <value>com.phumzile.acme.model.Game</value> <value>com.phumzile.acme.model.Book</value> <!-- Entities --> </list> </property> <property name="packagesToScan" value="com.phumzile.acme" /> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">${jdbc.hibernate.dialect </prop> <prop key="hibernate.hbm2ddl.auto">validate</prop> <prop key="hibernate.show_sql">true</prop> </props> </property> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory"> <ref bean="sessionFactory" /> </property> </bean> <tx:annotation-driven /> </beans> CONFIGURATION.PROPERTIES jdbc.driver.className=com.mysql.jdbc.Driver jdbc.url=jdbc:mysql://localhost:3306/mydb jdbc.username=root jdbc.password=root jdbc.hibernate.dialect=org.hibernate.dialect.MySQLDialect

    Read the article

  • Why is Varnish not caching?

    - by Justin
    I am troubleshooting the setup of Varnish 3.x on my Ubuntu server. I'm running Drupal 7 on two sites set up on the box, via named-based vhosts. Before trying to get Varnish to play nice with Drupal I'm trying to just get Varnish to a PNG from cache. Here are the headers I get from a curl -I request of the PNG file: HTTP/1.1 200 OK Server: Apache/2.2.22 (Ubuntu) Last-Modified: Sun, 07 Oct 2012 21:18:59 GMT ETag: "a57c2-3850-4cb7ea73db6c0" Accept-Ranges: bytes Content-Length: 14416 Cache-Control: max-age=1209600 Expires: Thu, 25 Oct 2012 22:55:14 GMT Content-Type: image/png Accept-Ranges: bytes Date: Thu, 11 Oct 2012 22:55:14 GMT X-Varnish: 1766703058 Age: 0 Via: 1.1 varnish Connection: keep-alive X-Varnish-Cache: MISS Here is the Varnish VCL file I'm using (It's a default VCL configuration designed for Drupal): # Default backend definition. Set this to point to your content # server. # backend default { .host = "127.0.0.1"; .port = "8080"; } # Respond to incoming requests. sub vcl_recv { # Use anonymous, cached pages if all backends are down. if (!req.backend.healthy) { unset req.http.Cookie; } # Allow the backend to serve up stale content if it is responding slowly. set req.grace = 6h; # Pipe these paths directly to Apache for streaming. #if (req.url ~ "^/admin/content/backup_migrate/export") { # return (pipe); #} # Do not cache these paths. if (req.url ~ "^/status\.php$" || req.url ~ "^/update\.php$" || req.url ~ "^/admin$" || req.url ~ "^/admin/.*$" || req.url ~ "^/flag/.*$" || req.url ~ "^.*/ajax/.*$" || req.url ~ "^.*/ahah/.*$") { return (pass); } # Do not allow outside access to cron.php or install.php. #if (req.url ~ "^/(cron|install)\.php$" && !client.ip ~ internal) { # Have Varnish throw the error directly. # error 404 "Page not found."; # Use a custom error page that you've defined in Drupal at the path "404". # set req.url = "/404"; #} # Always cache the following file types for all users. This list of extensions # appears twice, once here and again in vcl_fetch so make sure you edit both # and keep them equal. if (req.url ~ "(?i)\.(pdf|asc|dat|txt|doc|xls|ppt|tgz|csv|png|gif|jpeg|jpg|ico|swf|css|js)(\?.*)?$") { unset req.http.Cookie; } # Remove all cookies that Drupal doesn't need to know about. We explicitly # list the ones that Drupal does need, the SESS and NO_CACHE. If, after # running this code we find that either of these two cookies remains, we # will pass as the page cannot be cached. if (req.http.Cookie) { # 1. Append a semi-colon to the front of the cookie string. # 2. Remove all spaces that appear after semi-colons. # 3. Match the cookies we want to keep, adding the space we removed # previously back. (\1) is first matching group in the regsuball. # 4. Remove all other cookies, identifying them by the fact that they have # no space after the preceding semi-colon. # 5. Remove all spaces and semi-colons from the beginning and end of the # cookie string. set req.http.Cookie = ";" + req.http.Cookie; set req.http.Cookie = regsuball(req.http.Cookie, "; +", ";"); set req.http.Cookie = regsuball(req.http.Cookie, ";(SESS[a-z0-9]+|SSESS[a-z0-9]+|NO_CACHE)=", "; \1="); set req.http.Cookie = regsuball(req.http.Cookie, ";[^ ][^;]*", ""); set req.http.Cookie = regsuball(req.http.Cookie, "^[; ]+|[; ]+$", ""); if (req.http.Cookie == "") { # If there are no remaining cookies, remove the cookie header. If there # aren't any cookie headers, Varnish's default behavior will be to cache # the page. unset req.http.Cookie; } else { # If there is any cookies left (a session or NO_CACHE cookie), do not # cache the page. Pass it on to Apache directly. return (pass); } } } # Set a header to track a cache HIT/MISS. sub vcl_deliver { if (obj.hits > 0) { set resp.http.X-Varnish-Cache = "HIT"; } else { set resp.http.X-Varnish-Cache = "MISS"; } } # Code determining what to do when serving items from the Apache servers. # beresp == Back-end response from the web server. sub vcl_fetch { # We need this to cache 404s, 301s, 500s. Otherwise, depending on backend but # definitely in Drupal's case these responses are not cacheable by default. if (beresp.status == 404 || beresp.status == 301 || beresp.status == 500) { set beresp.ttl = 10m; } # Don't allow static files to set cookies. # (?i) denotes case insensitive in PCRE (perl compatible regular expressions). # This list of extensions appears twice, once here and again in vcl_recv so # make sure you edit both and keep them equal. if (req.url ~ "(?i)\.(pdf|asc|dat|txt|doc|xls|ppt|tgz|csv|png|gif|jpeg|jpg|ico|swf|css|js)(\?.*)?$") { unset beresp.http.set-cookie; } # Allow items to be stale if needed. set beresp.grace = 6h; } # In the event of an error, show friendlier messages. sub vcl_error { # Redirect to some other URL in the case of a homepage failure. #if (req.url ~ "^/?$") { # set obj.status = 302; # set obj.http.Location = "http://backup.example.com/"; #} # Otherwise redirect to the homepage, which will likely be in the cache. set obj.http.Content-Type = "text/html; charset=utf-8"; synthetic {" <html> <head> <title>Page Unavailable</title> <style> body { background: #303030; text-align: center; color: white; } #page { border: 1px solid #CCC; width: 500px; margin: 100px auto 0; padding: 30px; background: #323232; } a, a:link, a:visited { color: #CCC; } .error { color: #222; } </style> </head> <body onload="setTimeout(function() { window.location = '/' }, 5000)"> <div id="page"> <h1 class="title">Page Unavailable</h1> <p>The page you requested is temporarily unavailable.</p> <p>We're redirecting you to the <a href="/">homepage</a> in 5 seconds.</p> <div class="error">(Error "} + obj.status + " " + obj.response + {")</div> </div> </body> </html> "}; return (deliver); } I'm getting a MISS and age 0 every time. If I'm understanding correctly, this means the file isn't being returned from Varnish's cache. Is there a problem with my Varnish config?

    Read the article

  • How to? WCF customBinding over Https

    - by user663414
    Hi all, I'm trying to setup a WCF service for internal use, on our external facing web-farm (we dont have a web farm internally, and I need this service to have failover and load-balancing). Requirements: PerSession state, as we need the service to retain variable data for each session. HTTPS. After lots of googling i've read I needed to create a customBinding, which I've done, but not sure if it is correct. Larger message size, as one of the parameters is a byte[] array, which can be a max of 5mb. no requirement to manually edit the client-side app.config. ie, I need the Developer to just add the service reference, and then starts using the object without fiddly changing of app.config. Note: I've previously had this service working under HTTP correctly (using wsHttpBinding). I've also had it working under HTTPS, but it didn't support PerSession state, and lost internal variable values each function call. I'm currently getting this error from the test harness: Could not find default endpoint element that references contract 'AppMonitor.IAppMonitorWcfService' in the ServiceModel client configuration section. This might be because no configuration file was found for your application, or because no endpoint element matching this contract could be found in the client element. NOTE: The error is arising on an Test Harness EXE, that has the WCF service referenced directly under Service References. This is not the problem of an exe referencing another object, that then references the WCF service, that i've read about. The WSDL is showing correctly when browsing to the URL. Web.Config: <system.serviceModel> <services> <service name="AppMonitor.AppMonitorWcfService" behaviorConfiguration="ServiceBehavior"> <endpoint address="" binding="customBinding" bindingConfiguration="EnablePerSessionUnderHttps" contract="AppMonitor.IAppMonitorWcfService"/> <endpoint address="mex" binding="mexHttpsBinding" contract="IMetadataExchange" /> </service> </services> <bindings> <customBinding> <binding name="EnablePerSessionUnderHttps" maxReceivedMessageSize="5242880"> <reliableSession ordered="true"/> <textMessageEncoding> <readerQuotas maxDepth="64" maxStringContentLength="2147483647" maxArrayLength="2147483647" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> </textMessageEncoding> <httpsTransport authenticationScheme="Anonymous" requireClientCertificate="false"/> </binding> </customBinding> </bindings> <behaviors> <serviceBehaviors> <behavior name="ServiceBehavior"> <serviceMetadata httpsGetEnabled="true" httpGetEnabled="false"/> <serviceDebug includeExceptionDetailInFaults="true"/> </behavior> </serviceBehaviors> </behaviors> </system.serviceModel> EXE's App.config (auto-generated when adding the Service Reference): <configuration> <system.serviceModel> <bindings> <wsHttpBinding> <binding name="CustomBinding_IAppMonitorWcfService" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" bypassProxyOnLocal="false" transactionFlow="false" hostNameComparisonMode="StrongWildcard" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" useDefaultWebProxy="true" allowCookies="false"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="true" /> <security mode="Transport"> <transport clientCredentialType="None" proxyCredentialType="None" realm="" /> <message clientCredentialType="Windows" negotiateServiceCredential="true" establishSecurityContext="true" /> </security> </binding> </wsHttpBinding> </bindings> <client /> </system.serviceModel> </configuration> I'm not sure why the app.config is showing wsHttpBinding? Shouldn't this be customBinding? I really dont want to have to edit the app.config, as this service will be used by dozens of developers, and I want them to just be able to add the Service Reference, and away they go... Using VS2008, .NET 3.51. I think server is IIS7, Win Server 2008, can confirm if needed.

    Read the article

  • Object oriented n-tier design. Am I abstracting too much? Or not enough?

    - by max
    Hi guys, I'm building my first enterprise grade solution (at least I'm attempting to make it enterprise grade). I'm trying to follow best practice design patterns but am starting to worry that I might be going too far with abstraction. I'm trying to build my asp.net webforms (in C#) app as an n-tier application. I've created a Data Access Layer using an XSD strongly-typed dataset that interfaces with a SQL server backend. I access the DAL through some Business Layer Objects that I've created on a 1:1 basis to the datatables in the dataset (eg, a UsersBLL class for the Users datatable in the dataset). I'm doing checks inside the BLL to make sure that data passed to DAL is following the business rules of the application. That's all well and good. Where I'm getting stuck though is the point at which I connect the BLL to the presentation layer. For example, my UsersBLL class deals mostly with whole datatables, as it's interfacing with the DAL. Should I now create a separate "User" (Singular) class that maps out the properties of a single user, rather than multiple users? This way I don't have to do any searching through datatables in the presentation layer, as I could use the properties created in the User class. Or would it be better to somehow try to handle this inside the UsersBLL? Sorry if this sounds a little complicated... Below is the code from the UsersBLL: using System; using System.Data; using PedChallenge.DAL.PedDataSetTableAdapters; [System.ComponentModel.DataObject] public class UsersBLL { private UsersTableAdapter _UsersAdapter = null; protected UsersTableAdapter Adapter { get { if (_UsersAdapter == null) _UsersAdapter = new UsersTableAdapter(); return _UsersAdapter; } } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Select, true)] public PedChallenge.DAL.PedDataSet.UsersDataTable GetUsers() { return Adapter.GetUsers(); } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Select, false)] public PedChallenge.DAL.PedDataSet.UsersDataTable GetUserByUserID(int userID) { return Adapter.GetUserByUserID(userID); } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Select, false)] public PedChallenge.DAL.PedDataSet.UsersDataTable GetUsersByTeamID(int teamID) { return Adapter.GetUsersByTeamID(teamID); } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Select, false)] public PedChallenge.DAL.PedDataSet.UsersDataTable GetUsersByEmail(string Email) { return Adapter.GetUserByEmail(Email); } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Insert, true)] public bool AddUser(int? teamID, string FirstName, string LastName, string Email, string Role, int LocationID) { // Create a new UsersRow instance PedChallenge.DAL.PedDataSet.UsersDataTable Users = new PedChallenge.DAL.PedDataSet.UsersDataTable(); PedChallenge.DAL.PedDataSet.UsersRow user = Users.NewUsersRow(); if (UserExists(Users, Email) == true) return false; if (teamID == null) user.SetTeamIDNull(); else user.TeamID = teamID.Value; user.FirstName = FirstName; user.LastName = LastName; user.Email = Email; user.Role = Role; user.LocationID = LocationID; // Add the new user Users.AddUsersRow(user); int rowsAffected = Adapter.Update(Users); // Return true if precisely one row was inserted, // otherwise false return rowsAffected == 1; } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Update, true)] public bool UpdateUser(int userID, int? teamID, string FirstName, string LastName, string Email, string Role, int LocationID) { PedChallenge.DAL.PedDataSet.UsersDataTable Users = Adapter.GetUserByUserID(userID); if (Users.Count == 0) // no matching record found, return false return false; PedChallenge.DAL.PedDataSet.UsersRow user = Users[0]; if (teamID == null) user.SetTeamIDNull(); else user.TeamID = teamID.Value; user.FirstName = FirstName; user.LastName = LastName; user.Email = Email; user.Role = Role; user.LocationID = LocationID; // Update the product record int rowsAffected = Adapter.Update(user); // Return true if precisely one row was updated, // otherwise false return rowsAffected == 1; } [System.ComponentModel.DataObjectMethodAttribute (System.ComponentModel.DataObjectMethodType.Delete, true)] public bool DeleteUser(int userID) { int rowsAffected = Adapter.Delete(userID); // Return true if precisely one row was deleted, // otherwise false return rowsAffected == 1; } private bool UserExists(PedChallenge.DAL.PedDataSet.UsersDataTable users, string email) { // Check if user email already exists foreach (PedChallenge.DAL.PedDataSet.UsersRow userRow in users) { if (userRow.Email == email) return true; } return false; } } Some guidance in the right direction would be greatly appreciated!! Thanks all! Max

    Read the article

  • high tweet status IDs causing failed to open stream errors?

    - by escarp
    Erg. Starting in the past few days high tweet IDs (at least, it appears it's ID related, but I suppose it could be some recent change in the api returns) are breaking my code. At first I tried passing the ID as a string instead of an integer to this function, and I thought this worked, but in reality it was just the process of uploading the file from my end. In short, a php script generates these function calls, and when it does so, they fail. If I download the php file the call is generated into, delete the server copy and re-upload the exact same file without changing it, it works fine. Does anyone know what could be causing this behavior? Below is what I suspect to be the most important part of the individual files that are pulling the errors. Each of the files is named for a status ID (e.g. the below file is named 12058543656.php) <?php require "singlePost.php"; SinglePost(12058543656) ?> Here's the code that writes the above files: $postFileName = $single_post_id.".php"; if(!file_exists($postFileName)){ $created_at_full = date("l, F jS, Y", strtotime($postRow[postdate])-(18000)); $postFileHandle = fopen($postFileName, 'w+'); fwrite($postFileHandle, '<html> <head> <title><?php $thisTITLE = "escarp | A brief poem or short story by '.$authorname.' on '.$created_at_full.'"; echo $thisTITLE;?></title><META NAME="Description" CONTENT="This brief poem or short story, by '.$authorname.', was published on '.$created_at_full.'"> <?php include("head.php");?> To receive other poems or short stories like this one from <a href=http://twitter.com/escarp>escarp</a> on your cellphone, <a href=http://twitter.com/signup>create</a> and/or <a href=http://twitter.com/devices>associate</a> a Twitter account with your cellphone</a>, follow <a href=http://twitter.com/escarp>us</a>, and turn device updates on. <pre><?php require "singlePost.php"; SinglePost("'.$single_post_id.'") ?> </div></div></pre><?php include("foot.php");?> </body> </html>'); fclose($postFileHandle);} $postcounter++; } I can post more if you don't see anything here, but there are several files involved and I'm trying to avoid dumping tons of irrelevant code. Error: Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include() [function.include]: Failed opening 'head.php' for inclusion (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 4 To receive other poems or short stories like this one from escarp on your cellphone, create and/or associate a Twitter account with your cellphone, follow us, and turn device updates on. Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Fatal error: require() [function.require]: Failed opening required 'singlePost.php' (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 7 <?php function SinglePost($statusID) { require "nicetime.php"; $db = sqlite_open("db.escarp"); $updates = sqlite_query($db, "SELECT * FROM posts WHERE postID = '$statusID'"); $row = sqlite_fetch_array($updates, SQLITE_ASSOC); $id = $row[authorID]; $result = sqlite_query($db, "SELECT * FROM authors WHERE authorID = '$id'"); $row5 = sqlite_fetch_array($result, SQLITE_ASSOC); $created_at_full = date("l, F jS, Y", strtotime($row[postdate])-(18000)); $created_at = nicetime($row[postdate]); if($row5[url]==""){ $authorurl = ''; } else{ /*I'm omitting a few pages of output code and associated regex*/ return; } ?>

    Read the article

  • Mobile enabled web apps with ASP.NET MVC 3 and jQuery Mobile

    - by shiju
    In my previous blog posts, I have demonstrated a simple web app using ASP.NET MVC 3 and EF Code First. In this post, I will be focus on making this application for mobile devices. A single web site will be used for both mobile browsers and desktop browsers. If users are accessing the web app from mobile browsers, users will be redirect to mobile specific pages and will get normal pages if users are accessing from desktop browsers. In this demo app, the mobile specific pages are maintained in an ASP.NET MVC Area named Mobile and mobile users will be redirect to MVC Area Mobile. Let’s add a new area named Mobile to the ASP.NET MVC app. For adding Area, right click the ASP.NET MVC project and  select Area from Add option. Our mobile specific pages using jQuery Mobile will be maintained in the Mobile Area. ASP.NET MVC Global filter for redirecting mobile visitors to Mobile area Let’s add an ASP.NET MVC Global filter for redirecting mobile visitors to Mobile area. The below Global filter is taken from the sample app http://aspnetmobilesamples.codeplex.com/ created by the ASP.NET team. The below filer will redirect the Mobile visitors to an ASP.NET MVC Area Mobile. public class RedirectMobileDevicesToMobileAreaAttribute : AuthorizeAttribute     {         protected override bool AuthorizeCore(System.Web.HttpContextBase httpContext)         {             // Only redirect on the first request in a session             if (!httpContext.Session.IsNewSession)                 return true;               // Don't redirect non-mobile browsers             if (!httpContext.Request.Browser.IsMobileDevice)                 return true;               // Don't redirect requests for the Mobile area             if (Regex.IsMatch(httpContext.Request.Url.PathAndQuery, "/Mobile($|/)"))                 return true;               return false;         }           protected override void HandleUnauthorizedRequest(AuthorizationContext filterContext)         {             var redirectionRouteValues = GetRedirectionRouteValues(filterContext.RequestContext);             filterContext.Result = new RedirectToRouteResult(redirectionRouteValues);         }           // Override this method if you want to customize the controller/action/parameters to which         // mobile users would be redirected. This lets you redirect users to the mobile equivalent         // of whatever resource they originally requested.         protected virtual RouteValueDictionary GetRedirectionRouteValues(RequestContext requestContext)         {             return new RouteValueDictionary(new { area = "Mobile", controller = "Home", action = "Index" });         }     } Let’s add the global filer RedirectMobileDevicesToMobileAreaAttribute to the global filter collection in the Application_Start() of Global.asax.cs file   GlobalFilters.Filters.Add(new RedirectMobileDevicesToMobileAreaAttribute(), 1); Now your mobile visitors will be redirect to the Mobile area. But the browser detection logic in the RedirectMobileDevicesToMobileAreaAttribute filter will not be working in some modern browsers and some conditions. But the good news is that ASP.NET’s browser detection feature is extensible and will be greatly working with the open source framework 51Degrees.mobi. 51Degrees.mobi is a Browser Capabilities Provider that will be working with ASP.NET’s Request.Browser and will provide more accurate and detailed information. For more details visit the documentation page at http://51degrees.codeplex.com/documentation. Let’s add a reference to 51Degrees.mobi library using NuGet We can easily add the 51Degrees.mobi from NuGet and this will update the web.config for necessary configuartions. Mobile Web App using jQuery Mobile Framework jQuery Mobile Framework is built on top of jQuery that provides top-of-the-line JavaScript in a unified User Interface that works across the most-used smartphone web browsers and tablet form factors. It provides an easy way to develop user interfaces for mobile web apps. The current version of the framework is jQuery Mobile Alpha 3. We need to include the following files to use jQuery Mobile. The jQuery Mobile CSS file (jquery.mobile-1.0a3.min.css) The jQuery library (jquery-1.5.min.js) The jQuery Mobile library (jquery.mobile-1.0a3.min.js) Let’s add the required jQuery files directly from jQuery CDN . You can download the files and host them on your own server. jQuery Mobile page structure The basic jQuery Mobile page structure is given below <!DOCTYPE html> <html>   <head>   <title>Page Title</title>   <link rel="stylesheet" href="http://code.jquery.com/mobile/1.0a3/jquery.mobile-1.0a1.min.css" />   <script src="http://code.jquery.com/jquery-1.5.min.js"></script>   <script src="http://code.jquery.com/mobile/1.0a3/jquery.mobile-1.0a3.min.js"></script> </head> <body> <div data-role="page">   <div data-role="header">     <h1>Page Title</h1>   </div>   <div data-role="content">     <p>Page content goes here.</p>      </div>   <div data-role="footer">     <h4>Page Footer</h4>   </div> </div> </body> </html> The data- attributes are the new feature of HTML5 so that jQuery Mobile will be working on browsers that supporting HTML 5. You can get a detailed browser support details from http://jquerymobile.com/gbs/ . In the Head section we have included the Core jQuery javascript file and jQuery Mobile Library and the core CSS Library for the UI Element Styling. These jQuery files are minified versions and will improve the performance of page load on Mobile Devices. The jQuery Mobile pages are identified with an element with the data-role="page" attribute inside the <body> tag. <div data-role="page"> </div> Within the "page" container, any valid HTML markup can be used, but for typical pages in jQuery Mobile, the immediate children of a "page" are div element with data-roles of "header", "content", and "footer". <div data-role="page">     <div data-role="header">...</div>     <div data-role="content">...</div>     <div data-role="footer">...</div> </div> The div data-role="content" holds the main content of the HTML page and will be used for making user interaction elements. The div data-role="header" is header part of the page and div data-role="footer" is the footer part of the page. Creating Mobile specific pages in the Mobile Area Let’s create Layout page for our Mobile area <!DOCTYPE html> <html> <head>     <title>@ViewBag.Title</title>     <link rel="stylesheet" href="http://code.jquery.com/mobile/1.0a3/jquery.mobile-1.0a3.min.css" />     <script src="http://code.jquery.com/jquery-1.5.min.js"></script>     <script src="http://code.jquery.com/mobile/1.0a3/jquery.mobile-1.0a3.min.js"></script>     </head>      <body> @RenderBody()    </body> </html> In the Layout page, I have given reference to jQuery Mobile JavaScript files and the CSS file. Let’s add an Index view page Index.chtml @{     ViewBag.Title = "Index"; } <div data-role="page"> <div data-role="header">      <h1>Expense Tracker Mobile</h1> </div> <div data-role="content">   <ul data-role="listview">     <li>@Html.Partial("_LogOnPartial")</li>      <li>@Html.ActionLink("Home", "Index", "Home")</li>      <li>@Html.ActionLink("Category", "Index", "Category")</li>                          <li>@Html.ActionLink("Expense", "Index", "Expense")</li> </ul> </div> <div data-role="footer">           Shiju Varghese | <a href="http://weblogs.asp.net/shijuvarghese">Blog     </a> | <a href="http://twitter.com/shijucv">Twitter</a>   </div> </div>   In the Index page, we have used data-role “listview” for showing our content as List View Let’s create a data entry screen create.cshtml @model MyFinance.Domain.Category @{     ViewBag.Title = "Create Category"; }   <div data-role="page"> <div data-role="header">      <h1>Create Category</h1>             @Html.ActionLink("Home", "Index","Home",null, new { @class = "ui-btn-right" })      </div>       <div data-role="content">     @using (Html.BeginForm("Create","Category",FormMethod.Post))     {       <div data-role="fieldcontain">        @Html.LabelFor(model => model.Name)        @Html.EditorFor(model => model.Name)        <div>           @Html.ValidationMessageFor(m => m.Name)        </div>         </div>         <div data-role="fieldcontain">         @Html.LabelFor(model => model.Description)         @Html.EditorFor(model => model.Description)                   </div>                    <div class="ui-body ui-body-b">         <button type="submit" data-role="button" data-theme="b">Save</button>       </div>     }        </div> </div>   In jQuery Mobile, the form elements should be placed inside the data-role="fieldcontain" The below screen shots show the pages rendered in mobile browser Index Page Create Page Source Code You can download the source code from http://efmvc.codeplex.com   Summary We have created a single  web app for desktop browsers and mobile browsers. If a user access the site from desktop browsers, users will get normal web pages and get mobile specific pages if users access from mobile browsers. If users are accessing the website from mobile devices, we will redirect to a ASP.NET MVC area Mobile. For redirecting to the Mobile area, we have used a Global filer for the redirection logic and used open source framework 51Degrees.mobi for the better support for mobile browser detection. In the Mobile area, we have created the pages using jQuery Mobile and users will get mobile friendly web pages. We can create great mobile web apps using ASP.NET MVC  and jQuery Mobile Framework.

    Read the article

  • CodePlex Daily Summary for Friday, March 12, 2010

    CodePlex Daily Summary for Friday, March 12, 2010New Projects.NET DEPENDENCY INJECTION: Abel Perez Enterprise FrameworkAutodocs - WCF REST Automatic API Documentation Generator: Autodocs is an automatic API documentation generator for .NET applications that use Windows Communication Foundation (WCF) to establish REST API's.BlockBlock: Block Block is a free game. You know Lumines and you will like BlockBlock.C4F XNA ASCII Post-Processing: This is the source code for the Coding4Fun article "XNA Effects – ASCII Art in 3D"ChequePrinter: this is ChequePrinterCompiladores MSIL usando Phoenix (PLP 2008.1 - CIn/UFPE): Este projeto foi feito com o intuito de explorar a plataforma Microsoft Phoenix para a construção de compiladores para MSIL de duas linguagens de E...CRM External View: CRM External View enables more robust control over exposing Microsoft CRM data (in a form of views) for external parties. The solution uses web ser...CS Project2: This is for the projectDotNetNuke IM Module of Facebook Like Messenger: Help you integrate 123 Web Messenger into DotNetNuke, and add a powerful 1-to-1 IM Software named "Facebook Messenger Style Web Chat Bar" at the bo...DotNetNuke® RadPanelBar: DNNRadPanelBar makes it easy to add telerik RadPanelBar functionality to your module or skin. Licensing permits anyone to use the components (incl...DotNetNuke® Skin Blocks: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by Armand Datema of Schwingsoft. This skin uses a bit of jQu...Drilltrough and filtering on SSAS-cubes in SSRS: We will describe a technique to create Reporting services (SSRS) reports that use Analysis services (SSAS) cubes as data sources, have a very intu...Ecosystem Diagnosis & Treatment: The Ecosystem DIagnosis & Treatment community provides tools, analyses and applications of the medical model to natural resource problems. EDT sof...ExIf 35: A utility for use by film photographers for keeping track of critical facts about images taken on a roll of film, just as digital cameras do automa...FabricadeTI: Desenvolvimento do framework FabricadeTI.Find and Replace word in the sentences: This program used Java Development Kid 6.0 and i were using HighLighter class. It was completed code with source code and then everybody can use in...Flash Nut: Flash Nut is a flash card program. You can build and review decks of flash cards. The project is a vs2008 wpf application.Free DotNetNuke Chat Module (Popup Mode): With this free DotNetNuke Chat Module (Popup Mode), master will assist to integrate DotNetNuke with 123 Flash Chat seamlessly, and add a popup mode...Free DotNetNuke IM of 123 Web Messenger -- Web-based Friend List: With this FREE application, you could integrate DNN website Database with 123 Web Messenger seamlessly and embed a web-based Friends List into anyw...Free DotNetNuke Live Help Module: With DotNetNuke Live Help Module, integrate 123 Live Help into DotNetNuke website and add Live Chat Button anywhere you like. Let visitors to chat ...G52GRP Videowall: NottinghamHappy Turtle Plugins for BVI :: Repository Based Versioning for Visual Studio: The Happy Turtle project creates plugins for the Build Version Increment Add-In for Visual Studio (BVI). The focus is to automatically version asse...Hasher: Hasher es capaz de generar el hash MD5 y SHA de textos de hasta 100.000 caracteres y ficheros. También te permitirá comprobar dos hash para verifi...Infragistics Silverlight Extended Controls: This project is a group of controls that extend or add functionality to the Infragistics Silverlight control suite. This control requires Infragis...Insert Video Jnr: This is a baby version of my Video plugin, it is intended for Hosted Wordpress blogs only and shouldn't be used with other blog providers.jccc .NET smart framework: jccc .NET smart framework allows the creation of fast connections to MSSQL or MYSQL databases, and the data manipulation by using of c# class's tha...LytScript: 函数式脚本语言Microsoft - DDD NLayerApp .NET 4.0 Example (Microsoft Spain): DDD NLayered App .NET 4.0 Example By Microsoft - Spain Domain Driven Design NLayered App .NET 4.0 Example Implementation Example of our local Arc...mimiKit: Lightweight ASP.NET MVC / Javascript Framework for creating mobile applications PHPWord: With PHPWord you can easily create a Word document with PHP. PHPWord creates docx Files that can include all major word functions like TextElements...Protocol Transition with BizTalk: An example solution the shows how todo Protocol Transition with BizTalk. This also shows you how to create a WCF extension to allow this to happen.Raid Runner: Raid Runner makes it easier to run and manage raid in World of Warcraft. It is a Silverlight application developed in c#SQL Server Authentication Troubleshooter: SQL Server Authentication Troubleshooter is a tool to help investigate a root cause of ‘Login Failed’ error in SQL Server. There could be number of...SuperviseObjects: SuperviseObjects consists of a collection which is derived from ObservableCollection<T>. This collection fires ItemPropertyChanging and ItemPropert...Viuto: Viuto.NET project aims to create a fully track and trace application. It is developed in: - Java & C: Firmware - C#: Parser - Asp.net: Tracki...Zealand IT MSBuild Tasks: Zealand IT MSBuild Tasks is a collection that you cannot do without if you are serious about continous integration. Ever wish you could specify an...New ReleasesASP.NET: ASP.NET MVC 2 RTM: This release contains the source code for ASP.NET MVC 2 RTM as well as the ASP.NET MVC Futures project. The futures project contains features that ...C#Mail: Higuchi.Mail.dll (2010.3.11 ver): Higuchi.Mail.dll at 2010-3-11 version.C#Mail: Higuchi.MailServer.dll (2010.3.11 ver): Higuchi.MailServer.dll at 2010.3.11 version.C4F XNA ASCII Post-Processing: XNA ASCII FPS v1 - Full Version: This is the full, complete example of the XNA ASCII FPS.C4F XNA ASCII Post-Processing: XNA ASCII FPS v1.0 - Base Project: This is the base project to be used by those who plan to follow along the Coding4Fun article.CRM External View: 1.0: Release 1.0DevTreks -social budgeting that improves lives and livelihoods: Social Budgeting Web Software, DevTreks alpha 3c: Alpha 3c upgrades custom/virtual uris (devpacks), temp uris, and zip packages. This is believed to be the first fully functional/performant release.DotNetNuke® RadPanelBar: DNNRadPanelBar 1.0.0: DNNRadPanelBar makes it easy to add telerik RadPanelBar functionality to your module or skin. Licensing permits anyone to use the components (inclu...Drilltrough and filtering on SSAS-cubes in SSRS: Release 1: Release 1ExIf 35: ExIf 35: Daily build of ExIf 35Family Tree Analyzer: Version 1.0.3.0: Version 1.0.3.0 Added options to check for updates on load and on help menu Disable use of US census for now until dealt with years being differen...Family Tree Analyzer: Version 1.0.4.0: Version 1.0.4.0 Added support for display of Ahnenfatel numbers Added filter to hide individuals from Lost Cousins report that have been flagged a...Flash Nut: Flash Nut 1.0 Setup: Flash Nut SetupFluent Validation for .NET: 1.2 RC: This is the release candidate for FluentValidation 1.2. If no bugs are found within the next couple of weeks, then this will become the 1.2 Final b...Free DotNetNuke Chat Module (Popup Mode): Download DNN Chat Module (Popup Mode)+Source Code: Feel free to download DotNetNuke Chat Module (Popup Mode), integrating DotNetNuke with 123 Flash Chat Software, and add a free popup mode flash cha...Free DotNetNuke Live Help Module: Download DNN Live Support Module and Source Code: In Readme file, there are detailed Installation and Integration Manual for you. This module is compatible with DotNetNuke v5.x.Happy Turtle Plugins for BVI :: Repository Based Versioning for Visual Studio: Happy Turtle 1.0.44927: This is the first release of the SVN based version incrementor. How To InstallMake sure that Build Version Increment v2.2.10065.1524 or newer is i...Hasher: 1.0: Versión inicial de la aplicación: Obtención de hash MD5 y SHA. Codificación en tiempo real de textos de hasta 100.000 caracteres. Codificación ...Jamolina: PhotosynthDemo: PhotosynthDemoMapWindow GIS: MapWindow 6.0 msi (March 11): This fixes an PixelToProj problem for the Extended Buffer case, as well as adding fixes to the WKBFeatureReader to fix an X,Y reversal and some ext...Math.NET Numerics: 2010.3.11.291 Build: Latest alpha buildMicrosoft - DDD NLayerApp .NET 4.0 Example (Microsoft Spain): V0.5 - N-Layer DDD Sample App: Required Software (Microsoft Base Software needed for Development environment) Unity Application Block 1.2 - October 2008 http://www.microsoft.com/...MiniTwitter: 1.09.2: MiniTwitter 1.09.2 更新内容 修正 タイムラインを削除すると落ちるバグを修正 稀にタイムラインのスクロールが出来ないバグを修正Nestoria.NET: Nestoria.NET 0.8: Provides access to the Nestoria API. Documentation contains a basic getting started guide. Please visit Darren Edge's blog for ongoing developmen...Pod Thrower: Version 1.0: Here is version 1.0. It has all the features I was looking to do in it. Please let me know if you use this and if you would like any changes.SharePoint Ad Rotator: SPAdRotator 2.0 Beta: This new release of the Ad Rotator contains many new features. One major new feature is that jQuery has been added to do image rotation without hav...SharePoint Objects: Democode Ton Stegeman: These download contains sample code for some SharePoint 2007 blog posts: TST.Themes_Build20100311.zip contains a feature receiver that registers Sh...SharePoint Taxonomy Extensions: SharePoint Taxonomy Extensions 1.2: Make Taxonomy Extensions useable in every list type. Not only in document libraries.SharePoint Video Player Web Part & SharePoint Video Library: Version 3.0.0: Absolutely killer feature - installing multiple players on a page without any loss of performance.SilverLight Interface for Mapserver: SLMapViewer v. 1.0: SLMapviewer sample application version 1.0. This new release includes the following enhancements: Silverlight 3.0 native Added a new init parame...Spark View Engine: Spark v1.1: Changes since RC1Built against ASP.NET MVC 2 RTMSPSS .NET interop library: 2.0: This new version supports SPSS 15, and includes spssio32.dll and other native .dll dependencies so that it works out of the box without SPSS being ...stefvanhooijdonk.com: SharePoint2010.ProfilePicturesLoader: So, with the help of Reflector, I wrote a small tool that would import all our profile pictures and update the user profiles. http://wp.me/pMnlQ-6G SuperviseObjects: SuperviseObjects 1.0: First releaseTortoiseSVN Addin for Visual Studio: TortoiseSVN Addin 1.0.5: Feature: Visual Studio/svn action synchronization on Item in Solution explorer like add, move, delete and rename. Note: Move action does not rememb...VCC: Latest build, v2.1.30311.0: Automatic drop of latest buildVivoSocial: VivoSocial 7.0.4: Business Management ■This release fixes a Could not load type error on the main view of the module. Groups ■Group requests were failing in some i...WikiPlex – a Regex Wiki Engine: WikiPlex 1.3: Info: Official Version: 1.3.0.215 | Full Release Notes Documentation - This new documentation includes Full Markup Guide with Examples Articles ...Zealand IT MSBuild Tasks: Zealand IT MSBuild Tasks: Initial beta release of Zealand IT MSBuild Tasks. Contains the following tasks: RunAs - Same as Exec task, but provides parameters for impersonat...ZoomBarPlus: V1 (Beta): This is the initial release. It should be considered a beta test version as it has not been tested for very long on my device.Most Popular ProjectsMetaSharpWBFS ManagerRawrAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)ASP.NET Ajax LibraryASP.NETMicrosoft SQL Server Community & SamplesMost Active ProjectsUmbraco CMSRawrN2 CMSBlogEngine.NETFasterflect - A Fast and Simple Reflection APIjQuery Library for SharePoint Web Servicespatterns & practices – Enterprise LibraryFarseer Physics EngineCaliburn: An Application Framework for WPF and SilverlightSharePoint Team-Mailer

    Read the article

  • Use IIS Application Initialization for keeping ASP.NET Apps alive

    - by Rick Strahl
    I've been working quite a bit with Windows Services in the recent months, and well, it turns out that Windows Services are quite a bear to debug, deploy, update and maintain. The process of getting services set up,  debugged and updated is a major chore that has to be extensively documented and or automated specifically. On most projects when a service is built, people end up scrambling for the right 'process' to use for administration. Web app deployment and maintenance on the other hand are common and well understood today, as we are constantly dealing with Web apps. There's plenty of infrastructure and tooling built into Web Tools like Visual Studio to facilitate the process. By comparison Windows Services or anything self-hosted for that matter seems convoluted.In fact, in a recent blog post I mentioned that on a recent project I'd been using self-hosting for SignalR inside of a Windows service, because the application is in fact a 'service' that also needs to send out lots of messages via SignalR. But the reality is that it could just as well be an IIS application with a service component that runs in the background. Either way you look at it, it's either a Windows Service with a built in Web Server, or an IIS application running a Service application, neither of which follows the standard Service or Web App template.Personally I much prefer Web applications. Running inside of IIS I get all the benefits of the IIS platform including service lifetime management (crash and restart), controlled shutdowns, the whole security infrastructure including easy certificate support, hot-swapping of code and the the ability to publish directly to IIS from within Visual Studio with ease.Because of these benefits we set out to move from the self hosted service into an ASP.NET Web app instead.The Missing Link for ASP.NET as a Service: Auto-LoadingI've had moments in the past where I wanted to run a 'service like' application in ASP.NET because when you think about it, it's so much easier to control a Web application remotely. Services are locked into start/stop operations, but if you host inside of a Web app you can write your own ticket and control it from anywhere. In fact nearly 10 years ago I built a background scheduling application that ran inside of ASP.NET and it worked great and it's still running doing its job today.The tricky part for running an app as a service inside of IIS then and now, is how to get IIS and ASP.NET launched so your 'service' stays alive even after an Application Pool reset. 7 years ago I faked it by using a web monitor (my own West Wind Web Monitor app) I was running anyway to monitor my various web sites for uptime, and having the monitor ping my 'service' every 20 seconds to effectively keep ASP.NET alive or fire it back up after a reload. I used a simple scheduler class that also includes some logic for 'self-reloading'. Hacky for sure, but it worked reliably.Luckily today it's much easier and more integrated to get IIS to launch ASP.NET as soon as an Application Pool is started by using the Application Initialization Module. The Application Initialization Module basically allows you to turn on Preloading on the Application Pool and the Site/IIS App, which essentially fires a request through the IIS pipeline as soon as the Application Pool has been launched. This means that effectively your ASP.NET app becomes active immediately, Application_Start is fired making sure your app stays up and running at all times. All the other features like Application Pool recycling and auto-shutdown after idle time still work, but IIS will then always immediately re-launch the application.Getting started with Application InitializationAs of IIS 8 Application Initialization is part of the IIS feature set. For IIS 7 and 7.5 there's a separate download available via Web Platform Installer. Using IIS 8 Application Initialization is an optional install component in Windows or the Windows Server Role Manager: This is an optional component so make sure you explicitly select it.IIS Configuration for Application InitializationInitialization needs to be applied on the Application Pool as well as the IIS Application level. As of IIS 8 these settings can be made through the IIS Administration console.Start with the Application Pool:Here you need to set both the Start Automatically which is always set, and the StartMode which should be set to AlwaysRunning. Both have to be set - the Start Automatically flag is set true by default and controls the starting of the application pool itself while Always Running flag is required in order to launch the application. Without the latter flag set the site settings have no effect.Now on the Site/Application level you can specify whether the site should pre load: Set the Preload Enabled flag to true.At this point ASP.NET apps should auto-load. This is all that's needed to pre-load the site if all you want is to get your site launched automatically.If you want a little more control over the load process you can add a few more settings to your web.config file that allow you to show a static page while the App is starting up. This can be useful if startup is really slow, so rather than displaying blank screen while the user is fiddling their thumbs you can display a static HTML page instead: <system.webServer> <applicationInitialization remapManagedRequestsTo="Startup.htm" skipManagedModules="true"> <add initializationPage="ping.ashx" /> </applicationInitialization> </system.webServer>This allows you to specify a page to execute in a dry run. IIS basically fakes request and pushes it directly into the IIS pipeline without hitting the network. You specify a page and IIS will fake a request to that page in this case ping.ashx which just returns a simple OK string - ie. a fast pipeline request. This request is run immediately after Application Pool restart, and while this request is running and your app is warming up, IIS can display an alternate static page - Startup.htm above. So instead of showing users an empty loading page when clicking a link on your site you can optionally show some sort of static status page that says, "we'll be right back".  I'm not sure if that's such a brilliant idea since this can be pretty disruptive in some cases. Personally I think I prefer letting people wait, but at least get the response they were supposed to get back rather than a random page. But it's there if you need it.Note that the web.config stuff is optional. If you don't provide it IIS hits the default site link (/) and even if there's no matching request at the end of that request it'll still fire the request through the IIS pipeline. Ideally though you want to make sure that an ASP.NET endpoint is hit either with your default page, or by specify the initializationPage to ensure ASP.NET actually gets hit since it's possible for IIS fire unmanaged requests only for static pages (depending how your pipeline is configured).What about AppDomain Restarts?In addition to full Worker Process recycles at the IIS level, ASP.NET also has to deal with AppDomain shutdowns which can occur for a variety of reasons:Files are updated in the BIN folderWeb Deploy to your siteweb.config is changedHard application crashThese operations don't cause the worker process to restart, but they do cause ASP.NET to unload the current AppDomain and start up a new one. Because the features above only apply to Application Pool restarts, AppDomain restarts could also cause your 'ASP.NET service' to stop processing in the background.In order to keep the app running on AppDomain recycles, you can resort to a simple ping in the Application_End event:protected void Application_End() { var client = new WebClient(); var url = App.AdminConfiguration.MonitorHostUrl + "ping.aspx"; client.DownloadString(url); Trace.WriteLine("Application Shut Down Ping: " + url); }which fires any ASP.NET url to the current site at the very end of the pipeline shutdown which in turn ensures that the site immediately starts back up.Manual Configuration in ApplicationHost.configThe above UI corresponds to the following ApplicationHost.config settings. If you're using IIS 7, there's no UI for these flags so you'll have to manually edit them.When you install the Application Initialization component into IIS it should auto-configure the module into ApplicationHost.config. Unfortunately for me, with Mr. Murphy in his best form for me, the module registration did not occur and I had to manually add it.<globalModules> <add name="ApplicationInitializationModule" image="%windir%\System32\inetsrv\warmup.dll" /> </globalModules>Most likely you won't need ever need to add this, but if things are not working it's worth to check if the module is actually registered.Next you need to configure the ApplicationPool and the Web site. The following are the two relevant entries in ApplicationHost.config.<system.applicationHost> <applicationPools> <add name="West Wind West Wind Web Connection" autoStart="true" startMode="AlwaysRunning" managedRuntimeVersion="v4.0" managedPipelineMode="Integrated"> <processModel identityType="LocalSystem" setProfileEnvironment="true" /> </add> </applicationPools> <sites> <site name="Default Web Site" id="1"> <application path="/MPress.Workflow.WebQueueMessageManager" applicationPool="West Wind West Wind Web Connection" preloadEnabled="true"> <virtualDirectory path="/" physicalPath="C:\Clients\…" /> </application> </site> </sites> </system.applicationHost>On the Application Pool make sure to set the autoStart and startMode flags to true and AlwaysRunning respectively. On the site make sure to set the preloadEnabled flag to true.And that's all you should need. You can still set the web.config settings described above as well.ASP.NET as a Service?In the particular application I'm working on currently, we have a queue manager that runs as standalone service that polls a database queue and picks out jobs and processes them on several threads. The service can spin up any number of threads and keep these threads alive in the background while IIS is running doing its own thing. These threads are newly created threads, so they sit completely outside of the IIS thread pool. In order for this service to work all it needs is a long running reference that keeps it alive for the life time of the application.In this particular app there are two components that run in the background on their own threads: A scheduler that runs various scheduled tasks and handles things like picking up emails to send out outside of IIS's scope and the QueueManager. Here's what this looks like in global.asax:public class Global : System.Web.HttpApplication { private static ApplicationScheduler scheduler; private static ServiceLauncher launcher; protected void Application_Start(object sender, EventArgs e) { // Pings the service and ensures it stays alive scheduler = new ApplicationScheduler() { CheckFrequency = 600000 }; scheduler.Start(); launcher = new ServiceLauncher(); launcher.Start(); // register so shutdown is controlled HostingEnvironment.RegisterObject(launcher); }}By keeping these objects around as static instances that are set only once on startup, they survive the lifetime of the application. The code in these classes is essentially unchanged from the Windows Service code except that I could remove the various overrides required for the Windows Service interface (OnStart,OnStop,OnResume etc.). Otherwise the behavior and operation is very similar.In this application ASP.NET serves two purposes: It acts as the host for SignalR and provides the administration interface which allows remote management of the 'service'. I can start and stop the service remotely by shutting down the ApplicationScheduler very easily. I can also very easily feed stats from the queue out directly via a couple of Web requests or (as we do now) through the SignalR service.Registering a Background Object with ASP.NETNotice also the use of the HostingEnvironment.RegisterObject(). This function registers an object with ASP.NET to let it know that it's a background task that should be notified if the AppDomain shuts down. RegisterObject() requires an interface with a Stop() method that's fired and allows your code to respond to a shutdown request. Here's what the IRegisteredObject::Stop() method looks like on the launcher:public void Stop(bool immediate = false) { LogManager.Current.LogInfo("QueueManager Controller Stopped."); Controller.StopProcessing(); Controller.Dispose(); Thread.Sleep(1500); // give background threads some time HostingEnvironment.UnregisterObject(this); }Implementing IRegisterObject should help with reliability on AppDomain shutdowns. Thanks to Justin Van Patten for pointing this out to me on Twitter.RegisterObject() is not required but I would highly recommend implementing it on whatever object controls your background processing to all clean shutdowns when the AppDomain shuts down.Testing it outI'm still in the testing phase with this particular service to see if there are any side effects. But so far it doesn't look like it. With about 50 lines of code I was able to replace the Windows service startup to Web start up - everything else just worked as is. An honorable mention goes to SignalR 2.0's oWin hosting, because with the new oWin based hosting no code changes at all were required, merely a couple of configuration file settings and an assembly directive needed, to point at the SignalR startup class. Sweet!It also seems like SignalR is noticeably faster running inside of IIS compared to self-host. Startup feels faster because of the preload.Starting and Stopping the 'Service'Because the application is running as a Web Server, it's easy to have a Web interface for starting and stopping the services running inside of the service. For our queue manager the SignalR service and front monitoring app has a play and stop button for toggling the queue.If you want more administrative control and have it work more like a Windows Service you can also stop the application pool explicitly from the command line which would be equivalent to stopping and restarting a service.To start and stop from the command line you can use the IIS appCmd tool. To stop:> %windir%\system32\inetsrv\appcmd stop apppool /apppool.name:"Weblog"and to start> %windir%\system32\inetsrv\appcmd start apppool /apppool.name:"Weblog"Note that when you explicitly force the AppPool to stop running either in the UI (on the ApplicationPools page use Start/Stop) or via command line tools, the application pool will not auto-restart immediately. You have to manually start it back up.What's not to like?There are certainly a lot of benefits to running a background service in IIS, but… ASP.NET applications do have more overhead in terms of memory footprint and startup time is a little slower, but generally for server applications this is not a big deal. If the application is stable the service should fire up and stay running indefinitely. A lot of times this kind of service interface can simply be attached to an existing Web application, or if scalability requires be offloaded to its own Web server.Easier to work withBut the ultimate benefit here is that it's much easier to work with a Web app as opposed to a service. While developing I can simply turn off the auto-launch features and launch the service on demand through IIS simply by hitting a page on the site. If I want to shut down an IISRESET -stop will shut down the service easily enough. I can then attach a debugger anywhere I want and this works like any other ASP.NET application. Yes you end up on a background thread for debugging but Visual Studio handles that just fine and if you stay on a single thread this is no different than debugging any other code.SummaryUsing ASP.NET to run background service operations is probably not a super common scenario, but it probably should be something that is considered carefully when building services. Many applications have service like features and with the auto-start functionality of the Application Initialization module, it's easy to build this functionality into ASP.NET. Especially when combined with the notification features of SignalR it becomes very, very easy to create rich services that can also communicate their status easily to the outside world.Whether it's existing applications that need some background processing for scheduling related tasks, or whether you just create a separate site altogether just to host your service it's easy to do and you can leverage the same tool chain you're already using for other Web projects. If you have lots of service projects it's worth considering… give it some thought…© Rick Strahl, West Wind Technologies, 2005-2013Posted in ASP.NET  SignalR  IIS   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Windows Phone 7 development: reading RSS feeds

    - by DigiMortal
    One limitation on Windows Phone 7 is related to System.Net namespace classes. There is no convenient way to read data from web. There is no WebClient class. There is no GetResponse() method – we have to do it all asynchronously because compact framework has limited set of classes we can use in our applications to communicate with internet. In this posting I will show you how to read RSS-feeds on Windows Phone 7. NB! This is my draft code and it may contain some design flaws and some questionable solutions. This code is intended to use as test-drive for Windows Phone 7 CTP developer tools and I don’t suppose you are going to use this code in production environment. Current state of my RSS-reader Currently my RSS-reader for Windows Phone 7 is very simple, primitive and uses almost all defaults that come out-of-box with Windows Phone 7 CTP developer tools. My first goal before going on with nicer user interface design was making RSS-reading work because instead of convenient classes from .NET Framework we have to use very limited classes from .NET Framework CE. This is why I took the reading of RSS-feeds as my first task. There are currently more things to solve regarding user-interface. As I am pretty new to all this Silverlight stuff I am not very sure if I can modify default controls easily or should I write my own controls that have better look and that work faster. The image on right shows you how my RSS-reader looks like right now. Upper side of screen is filled with list that shows headlines from this blog. The bottom part of screen is used to show description of selected posting. You can click on the image to see it in original size. In my next posting I will show you some improvements of my RSS-reader user interface that make it look nicer. But currently it is nice enough to make sure that RSS-feeds are read correctly. FeedItem class As this is most straight-forward part of the following code I will show you RSS-feed items class first. I think we have to stop on it because it is simple one. public class FeedItem {     public string Title { get; set; }     public string Description { get; set; }     public DateTime PublishDate { get; set; }     public List<string> Categories { get; set; }     public string Link { get; set; }       public FeedItem()     {         Categories = new List<string>();     } } RssClient RssClient takes feed URL and when asked it loads all items from feed and gives them back to caller through ItemsReceived event. Why it works this way? Because we can make responses only using asynchronous methods. I will show you in next section how to use this class. Although the code here is not very good but it works like expected. I will refactor this code later because it needs some more efforts and investigating. But let’s hope I find excellent solution. :) public class RssClient {     private readonly string _rssUrl;       public delegate void ItemsReceivedDelegate(RssClient client, IList<FeedItem> items);     public event ItemsReceivedDelegate ItemsReceived;       public RssClient(string rssUrl)     {         _rssUrl = rssUrl;     }       public void LoadItems()     {         var request = (HttpWebRequest)WebRequest.Create(_rssUrl);         var result = (IAsyncResult)request.BeginGetResponse(ResponseCallback, request);     }       void ResponseCallback(IAsyncResult result)     {         var request = (HttpWebRequest)result.AsyncState;         var response = request.EndGetResponse(result);           var stream = response.GetResponseStream();         var reader = XmlReader.Create(stream);         var items = new List<FeedItem>(50);           FeedItem item = null;         var pointerMoved = false;           while (!reader.EOF)         {             if (pointerMoved)             {                 pointerMoved = false;             }             else             {                 if (!reader.Read())                     break;             }               var nodeName = reader.Name;             var nodeType = reader.NodeType;               if (nodeName == "item")             {                 if (nodeType == XmlNodeType.Element)                     item = new FeedItem();                 else if (nodeType == XmlNodeType.EndElement)                     if (item != null)                     {                         items.Add(item);                         item = null;                     }                   continue;             }               if (nodeType != XmlNodeType.Element)                 continue;               if (item == null)                 continue;               reader.MoveToContent();             var nodeValue = reader.ReadElementContentAsString();             // we just moved internal pointer             pointerMoved = true;               if (nodeName == "title")                 item.Title = nodeValue;             else if (nodeName == "description")                 item.Description =  Regex.Replace(nodeValue,@"<(.|\n)*?>",string.Empty);             else if (nodeName == "feedburner:origLink")                 item.Link = nodeValue;             else if (nodeName == "pubDate")             {                 if (!string.IsNullOrEmpty(nodeValue))                     item.PublishDate = DateTime.Parse(nodeValue);             }             else if (nodeName == "category")                 item.Categories.Add(nodeValue);         }           if (ItemsReceived != null)             ItemsReceived(this, items);     } } This method is pretty long but it works. Now let’s try to use it in Windows Phone 7 application. Using RssClient And this is the fragment of code behing the main page of my application start screen. You can see how RssClient is initialized and how items are bound to list that shows them. public MainPage() {     InitializeComponent();       SupportedOrientations = SupportedPageOrientation.Portrait | SupportedPageOrientation.Landscape;     listBox1.Width = Width;       var rssClient = new RssClient("http://feedproxy.google.com/gunnarpeipman");     rssClient.ItemsReceived += new RssClient.ItemsReceivedDelegate(rssClient_ItemsReceived);     rssClient.LoadItems(); }   void rssClient_ItemsReceived(RssClient client, IList<FeedItem> items) {     Dispatcher.BeginInvoke(delegate()     {         listBox1.ItemsSource = items;     });            } Conclusion As you can see it was not very hard task to read RSS-feed and populate list with feed entries. Although we are not able to use more powerful classes that are part of full version on .NET Framework we can still live with limited set of classes that .NET Framework CE provides.

    Read the article

  • CodePlex Daily Summary for Thursday, March 18, 2010

    CodePlex Daily Summary for Thursday, March 18, 2010New ProjectsBordecal tools for FxCop: Bordecal tools for FxCop provides an extended framework for FxCop rule development. It allows rule developers to avoid using embedded XML resource...DotNetNuke® Skin City: A DotNetNuke Design Challenge skin package submitted to the "Personal" category by allsnnskins. We integrate orange color and black colour in this ...DotNetNuke® Skin Dawn: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by allsnnskins. This design reflects the theme of daylight. U...DotNetNuke® Skin Dream: A DotNetNuke Design Challenge skin package submitted to the "Personal" category by WhNuke. Uses the DNNJDMenu skin object.DotNetNuke® Skin Expression: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by Salar Golestanian of SalarO. This is a pure CSS skin with ...DotNetNuke® Skin ModernBiz: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by allsnnskins. This simple and unaffected company skin uses...DotNetNuke® Skin Profound: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by WhNuke Technology. This skin is simple and clean and the ...DotNetNuke® Skin Technology: A DotNetNuke Design Challenge skin package submitted to the "Modern Standards" category by allsnnskins. It's compatible with common browsers such ...DotNetNuke® Skin Unravel: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by Salar Golestanian of SalarO. This is a pure CSS skin wit...E! - ECMAScript Runtime Environment: E! (pronounced E-Bang) is a lightweight runtime environment for editing basic ECMAScript scripts with access to .NET Framework class libraries.Easy ArcGIS Library: Easy ArcGIS Library is a set of C# .net classes that wrap the common functionality of ArcObjects, that help ArcGIS developers do a lot of common fu...File Categorizer: The File Categorizer will help people tag the files on their system for easy searching. Instead of keyword searches, you can find files based on v...GMFS Cosmos: This is a file system for Cosmos a OS that was built with C# and we will be implementing this for windows and linuxIFilter Core Implementation (interface and structures): IFilter C# implementation for you to embed when writing Windows Search capabilities into your application.Image Wall Control for Silverlight: A control for Silverlight that emulates the wall of images in the Zune. imenik_za _dev4fun: imenik is a very simple program and easy to use where you can save and organise your contacts.LegoPhysX: LegoPhysX is an atomic based physics enginePersonal Accounting: Personal system for managing financial accounts, which supports multiple accounts in different currencies. It has movement imputation and basic que...Pipes & Filters Engine: The Pipes & Filters Engine allows you to process a sequence of separate operations (filters) asynchronously in a multi-threaded manner. Filters wil...Prerequisites Checker: Check preqrequisites for software. Example: Software S1 is delivered. S1 has prerequisites PR1, PR2... PRN You may load the config file for S...Puzzle Lib: A library for creating grid-and-tile puzzles. Includes two separate UIs for the Tetriminoes puzzle as examples.QuotesPlugin for Windows Live Writer: The QuotesPlugin for Windows Live Writer lists quotes from web sites such as quotes4all.net. It's very easy for you to select your favourite ones a...RobiJ2se: Robi j2se Learning!SkinEngine: This is a Skin Framework for C# Winform, It use easy.and Create Skin GreatSQL Azure .NET Connection: This is a demo application that shows how to connect with SQL AzureSupermarket Soft: WPF Application that helps you manage your supermarket shoppings.Tally Marks for Windows Phone 7 Series: Tally Marks is a counting application. It can count almost anything you'd like to count, and it does it with tally marks! Count the number of peo...TwitCast: TwitCast is a simple notifier for Twitter using the [url:http://linqtotwitter.codeplex.com/] LINQ 2 Twitter library.WodnySwiat: Projekt grupowy wodny światWSS Task Manager Activity: A custom task creation activity that can be used in a sequential or state machine workflow. The activity was specifically developed to handle task ...New ReleasesAddress Book: Address Book: Address BookAutoAudit: AutoAudit 1.10c: Veresion 1.10 includes most of the bug fix requests. adds createdby and modifiedby columns to the audited base tables. If the user name is set by...blog for umbraco 4: Blog 4 Umbraco 2.0.26: Fixes: -Regex bug in base -Directory urls and rss link bug -Open reader bug -Rss bugDotNetNuke® Skin City: City Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Personal" category by allsnnskins. We integrate orange color and black colour in this ...DotNetNuke® Skin Dawn: Dawn Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by allsnnskins. This design reflects the theme of daylight. U...DotNetNuke® Skin Dream: Dream Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Personal" category by WhNuke. Uses the DNNJDMenu skin object.DotNetNuke® Skin Expression: Expression Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by Salar Golestanian of SalarO. This is a pure CSS skin with ...DotNetNuke® Skin ModernBiz: ModernBiz Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by allsnnskins. This simple and unaffected company skin uses...DotNetNuke® Skin Profound: Profound Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by WhNuke Technology. This skin is simple and clean and the ...DotNetNuke® Skin Technology: Technology Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Modern Standards" category by allsnnskins. It's compatible with common browsers such a...DotNetNuke® Skin Unravel: Unravel Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Modern Business" category by Salar Golestanian of SalarO. This is a pure CSS skin with...E! - ECMAScript Runtime Environment: E! beta 1: This is really meant as a learning project for playing with dynamically compiled code, so you'd be better off getting the source code.Easy ArcGIS Library: EAGL Binaries: Easy ArcGIS Library Last Build (Version 1.1.2.4139)Easy ArcGIS Library: EAGL Binaries And Documentation: EAGL Latest Build With DocumentationEasy ArcGIS Library: EAGL Documentation: EAGL 1.1.2.4139 DocumentationEnterprise Library Extensions: Release 1.1: This is a service release for version 1.0 The installation process now works as intended. The assemblies are now visible in the Visual Studio As...Family Tree Analyzer: Version 1.2.1.0: Version 1.2.1.0 Fixed GB radio button not working renamed UK Added fixes for UK regions/shires/counties where country is missing Add country reco...Family Tree Analyzer: Version 1.3.0.0: Version 1.3.0.0 Added IGI Search results viewer Tweaked filenames of IGI search so that results window has more informative displayFile Archive: File Archive: If your computer is only word processing machine or document merge machine, this program is really fit for you. It's so...o useful! This program ar...GameStore League Manager: League Manager 1.0.4: Fixes bug 7434. Changed version number to the standard format of Major.Minor.ReleaseIFilter Core Implementation (interface and structures): Stable release: First release of interface implementation.IFilter Core Implementation (interface and structures): System.Search.Core: Ifilter interface for implementation in your own Search Providers.imenik_za _dev4fun: imenik_aplikacija: imenik aplikacija is an application easy to use where you can save and organise your contacts.KDRE - kernel debugger regular expression extension: KDRE 0.0.2: KDRE - Windbg regexp extension Changes: - amd64 build addedMapWindow6: MapWindow 6.0 msi (March 17): This release introduces some minor tweaks to the source code exposing more buffering functionality. This also fixes a problem with selecting point...MockingBird: MockingBird_2.0_RC: This is the V2.0 RC release. The documentation includes notes about the WCF components. Check this blog post for more details about the release. ...MPF for Projects - Visual Studio 2010: Visual Studio 2010 - Final Release: This contains the source code for the release of MPF for Projects corresponding to Visual Studio 2010. For Beta 2, you will need the Beta 2 release...Physics Helper for Silverlight, WPF, Blend, and Farseer: PhysicsHelper 3.0.0.4 ALPHA: This is an initial release that supports Windows Phone 7 Series Development, along with the Silverlight 3 and WPF support. It requires Visual Studi...Pocket GPW: Pocket GPW 1.2: Modyfikacje wg. change set-a 56678. Poprzednia baza danych (z wersji 1.1) jest zgodna z aktualną. Przed instalacją skopiuj poprzednią bazę danych ...Prerequisites Checker: Prerequisites Checker: Check your software prerequisitesPuzzle Lib: Puzzle Lib examples: Tetriminoes examples using a common Puzzle LIB and common Puzzle Implementation library, demonstrating a basic MVC architecture for game developmentRoTwee: RoTwee (8.0.7.0): Now you can rotate tweets by your hand !SharePoint Icon Integration: SharePoint Icon Integration PDF: This is the first stable release of the SPIconIntegration. To install the PDF Icon integration just start the setup.exe file that you will find in ...SkinEngine: SkinEngine-Src-2010-03-17: this is a release on 2010-03-17Spell Corrector: Spell Corrector 0.2 Binary: Fixed a bug in the word indexing in the database.Spell Corrector: Spell Corrector 0.2 Code: Fixed a bug in the indexing of the words in the database. Now insertion of new words in the database is faster.SQL Azure .NET Connection: LittleBlackBook.NET Release 1.0: This was a demo project for a SQL Azure Presentation at ConfooSQL Server Extended Properties Quick Editor: New release 1.5.5: Whats new: Move preferences to application settings and add a form to edit preferences. Support to add, modify and delete operations could be made ...SuperModel - A Dynamic View-Model Generator: 1.0.0.1 - Tyra+: Resolving a couple of bugs; models generated using INotifyPropertyChanged were not being created correctly. Property resolution on proxied types w...Survey - web survey & form engine: Survey 1.2.0: The Survey 1.2.0 release is based on the original sources of the Nsurvey 1.9 application. Compared to the Survey 1.1.0 version many new features ...T.S.T. the T-SQL Test Tool: Version 1.5: Version 1.5 changes: Bug fix. In V1.4 and earlier table comparison failed if the tables compared had columns with spaces in them.TwitCast: TwitCast 1.0.0.0: First release of TwitCast. Be warned that this is just a development release and there are a lot of things that remain to be done.unbinder: Unbound.dll: from change set ef6f2303dd32VCC: Latest build, v2.1.30317.0: Automatic drop of latest buildWatchersNET.TagCloud: WatchersNET.TagCloud 01.02.00: Whats New Show only Tags from Pages the Current User has View Acess (As Option) A Url can be specified for a Custom tag Added Module Package fo...WSS Task Manager Activity: 1.0: Download either the source for Moss Task Manager Activity, Workflow sample if you are interested to see how to use the activity in the workflow or ...XML pretty print for python (xmlpp): version 0.92b: Fixes issues when element name contains :Xpress - ASP.NET MVC 个人博客程序: xpress2.1.1.0317.beta: 最新beta版 更改内容: 模板与系统所需配置文件移动到App_Data中 Service对象注入到Controller中 Controller对象放入IOC容器中 邮件发送BUG修正Most Popular ProjectsMetaSharpRawrWBFS ManagerSilverlight ToolkitASP.NET Ajax LibraryMicrosoft SQL Server Product Samples: DatabaseAJAX Control ToolkitLiveUpload to FacebookWindows Presentation Foundation (WPF)ASP.NETMost Active ProjectsLINQ to TwitterRawrOData SDK for PHPDirectQOpen Data App Framework (ODAF)patterns & practices – Enterprise LibraryBlogEngine.NETjQuery Library for SharePoint Web ServicesMapWindow6NB_Store - Free DotNetNuke Ecommerce Catalog Module

    Read the article

  • Passing multiple POST parameters to Web API Controller Methods

    - by Rick Strahl
    ASP.NET Web API introduces a new API for creating REST APIs and making AJAX callbacks to the server. This new API provides a host of new great functionality that unifies many of the features of many of the various AJAX/REST APIs that Microsoft created before it - ASP.NET AJAX, WCF REST specifically - and combines them into a whole more consistent API. Web API addresses many of the concerns that developers had with these older APIs, namely that it was very difficult to build consistent REST style resource APIs easily. While Web API provides many new features and makes many scenarios much easier, a lot of the focus has been on making it easier to build REST compliant APIs that are focused on resource based solutions and HTTP verbs. But  RPC style calls that are common with AJAX callbacks in Web applications, have gotten a lot less focus and there are a few scenarios that are not that obvious, especially if you're expecting Web API to provide functionality similar to ASP.NET AJAX style AJAX callbacks. RPC vs. 'Proper' REST RPC style HTTP calls mimic calling a method with parameters and returning a result. Rather than mapping explicit server side resources or 'nouns' RPC calls tend simply map a server side operation, passing in parameters and receiving a typed result where parameters and result values are marshaled over HTTP. Typically RPC calls - like SOAP calls - tend to always be POST operations rather than following HTTP conventions and using the GET/POST/PUT/DELETE etc. verbs to implicitly determine what operation needs to be fired. RPC might not be considered 'cool' anymore, but for typical private AJAX backend operations of a Web site I'd wager that a large percentage of use cases of Web API will fall towards RPC style calls rather than 'proper' REST style APIs. Web applications that have needs for things like live validation against data, filling data based on user inputs, handling small UI updates often don't lend themselves very well to limited HTTP verb usage. It might not be what the cool kids do, but I don't see RPC calls getting replaced by proper REST APIs any time soon.  Proper REST has its place - for 'real' API scenarios that manage and publish/share resources, but for more transactional operations RPC seems a better choice and much easier to implement than trying to shoehorn a boatload of endpoint methods into a few HTTP verbs. In any case Web API does a good job of providing both RPC abstraction as well as the HTTP Verb/REST abstraction. RPC works well out of the box, but there are some differences especially if you're coming from ASP.NET AJAX service or WCF Rest when it comes to multiple parameters. Action Routing for RPC Style Calls If you've looked at Web API demos you've probably seen a bunch of examples of how to create HTTP Verb based routing endpoints. Verb based routing essentially maps a controller and then uses HTTP verbs to map the methods that are called in response to HTTP requests. This works great for resource APIs but doesn't work so well when you have many operational methods in a single controller. HTTP Verb routing is limited to the few HTTP verbs available (plus separate method signatures) and - worse than that - you can't easily extend the controller with custom routes or action routing beyond that. Thankfully Web API also supports Action based routing which allows you create RPC style endpoints fairly easily:RouteTable.Routes.MapHttpRoute( name: "AlbumRpcApiAction", routeTemplate: "albums/{action}/{title}", defaults: new { title = RouteParameter.Optional, controller = "AlbumApi", action = "GetAblums" } ); This uses traditional MVC style {action} method routing which is different from the HTTP verb based routing you might have read a bunch about in conjunction with Web API. Action based routing like above lets you specify an end point method in a Web API controller either via the {action} parameter in the route string or via a default value for custom routes. Using routing you can pass multiple parameters either on the route itself or pass parameters on the query string, via ModelBinding or content value binding. For most common scenarios this actually works very well. As long as you are passing either a single complex type via a POST operation, or multiple simple types via query string or POST buffer, there's no issue. But if you need to pass multiple parameters as was easily done with WCF REST or ASP.NET AJAX things are not so obvious. Web API has no issue allowing for single parameter like this:[HttpPost] public string PostAlbum(Album album) { return String.Format("{0} {1:d}", album.AlbumName, album.Entered); } There are actually two ways to call this endpoint: albums/PostAlbum Using the Model Binder with plain POST values In this mechanism you're sending plain urlencoded POST values to the server which the ModelBinder then maps the parameter. Each property value is matched to each matching POST value. This works similar to the way that MVC's  ModelBinder works. Here's how you can POST using the ModelBinder and jQuery:$.ajax( { url: "albums/PostAlbum", type: "POST", data: { AlbumName: "Dirty Deeds", Entered: "5/1/2012" }, success: function (result) { alert(result); }, error: function (xhr, status, p3, p4) { var err = "Error " + " " + status + " " + p3; if (xhr.responseText && xhr.responseText[0] == "{") err = JSON.parse(xhr.responseText).message; alert(err); } }); Here's what the POST data looks like for this request: The model binder and it's straight form based POST mechanism is great for posting data directly from HTML pages to model objects. It avoids having to do manual conversions for many operations and is a great boon for AJAX callback requests. Using Web API JSON Formatter The other option is to post data using a JSON string. The process for this is similar except that you create a JavaScript object and serialize it to JSON first.album = { AlbumName: "PowerAge", Entered: new Date(1977,0,1) } $.ajax( { url: "albums/PostAlbum", type: "POST", contentType: "application/json", data: JSON.stringify(album), success: function (result) { alert(result); } }); Here the data is sent using a JSON object rather than form data and the data is JSON encoded over the wire. The trace reveals that the data is sent using plain JSON (Source above), which is a little more efficient since there's no UrlEncoding that occurs. BTW, notice that WebAPI automatically deals with the date. I provided the date as a plain string, rather than a JavaScript date value and the Formatter and ModelBinder both automatically map the date propertly to the Entered DateTime property of the Album object. Passing multiple Parameters to a Web API Controller Single parameters work fine in either of these RPC scenarios and that's to be expected. ModelBinding always works against a single object because it maps a model. But what happens when you want to pass multiple parameters? Consider an API Controller method that has a signature like the following:[HttpPost] public string PostAlbum(Album album, string userToken) Here I'm asking to pass two objects to an RPC method. Is that possible? This used to be fairly straight forward either with WCF REST and ASP.NET AJAX ASMX services, but as far as I can tell this is not directly possible using a POST operation with WebAPI. There a few workarounds that you can use to make this work: Use both POST *and* QueryString Parameters in Conjunction If you have both complex and simple parameters, you can pass simple parameters on the query string. The above would actually work with: /album/PostAlbum?userToken=sekkritt but that's not always possible. In this example it might not be a good idea to pass a user token on the query string though. It also won't work if you need to pass multiple complex objects, since query string values do not support complex type mapping. They only work with simple types. Use a single Object that wraps the two Parameters If you go by service based architecture guidelines every service method should always pass and return a single value only. The input should wrap potentially multiple input parameters and the output should convey status as well as provide the result value. You typically have a xxxRequest and a xxxResponse class that wraps the inputs and outputs. Here's what this method might look like:public PostAlbumResponse PostAlbum(PostAlbumRequest request) { var album = request.Album; var userToken = request.UserToken; return new PostAlbumResponse() { IsSuccess = true, Result = String.Format("{0} {1:d} {2}", album.AlbumName, album.Entered,userToken) }; } with these support types:public class PostAlbumRequest { public Album Album { get; set; } public User User { get; set; } public string UserToken { get; set; } } public class PostAlbumResponse { public string Result { get; set; } public bool IsSuccess { get; set; } public string ErrorMessage { get; set; } }   To call this method you now have to assemble these objects on the client and send it up as JSON:var album = { AlbumName: "PowerAge", Entered: "1/1/1977" } var user = { Name: "Rick" } var userToken = "sekkritt"; $.ajax( { url: "samples/PostAlbum", type: "POST", contentType: "application/json", data: JSON.stringify({ Album: album, User: user, UserToken: userToken }), success: function (result) { alert(result.Result); } }); I assemble the individual types first and then combine them in the data: property of the $.ajax() call into the actual object passed to the server, that mimics the structure of PostAlbumRequest server class that has Album, User and UserToken properties. This works well enough but it gets tedious if you have to create Request and Response types for each method signature. If you have common parameters that are always passed (like you always pass an album or usertoken) you might be able to abstract this to use a single object that gets reused for all methods, but this gets confusing too: Overload a single 'parameter' too much and it becomes a nightmare to decipher what your method actual can use. Use JObject to parse multiple Property Values out of an Object If you recall, ASP.NET AJAX and WCF REST used a 'wrapper' object to make default AJAX calls. Rather than directly calling a service you always passed an object which contained properties for each parameter: { parm1: Value, parm2: Value2 } WCF REST/ASP.NET AJAX would then parse this top level property values and map them to the parameters of the endpoint method. This automatic type wrapping functionality is no longer available directly in Web API, but since Web API now uses JSON.NET for it's JSON serializer you can actually simulate that behavior with a little extra code. You can use the JObject class to receive a dynamic JSON result and then using the dynamic cast of JObject to walk through the child objects and even parse them into strongly typed objects. Here's how to do this on the API Controller end:[HttpPost] public string PostAlbum(JObject jsonData) { dynamic json = jsonData; JObject jalbum = json.Album; JObject juser = json.User; string token = json.UserToken; var album = jalbum.ToObject<Album>(); var user = juser.ToObject<User>(); return String.Format("{0} {1} {2}", album.AlbumName, user.Name, token); } This is clearly not as nice as having the parameters passed directly, but it works to allow you to pass multiple parameters and access them using Web API. JObject is JSON.NET's generic object container which sports a nice dynamic interface that allows you to walk through the object's properties using standard 'dot' object syntax. All you have to do is cast the object to dynamic to get access to the property interface of the JSON type. Additionally JObject also allows you to parse JObject instances into strongly typed objects, which enables us here to retrieve the two objects passed as parameters from this jquery code:var album = { AlbumName: "PowerAge", Entered: "1/1/1977" } var user = { Name: "Rick" } var userToken = "sekkritt"; $.ajax( { url: "samples/PostAlbum", type: "POST", contentType: "application/json", data: JSON.stringify({ Album: album, User: user, UserToken: userToken }), success: function (result) { alert(result); } }); Summary ASP.NET Web API brings many new features and many advantages over the older Microsoft AJAX and REST APIs, but realize that some things like passing multiple strongly typed object parameters will work a bit differently. It's not insurmountable, but just knowing what options are available to simulate this behavior is good to know. Now let me say here that it's probably not a good practice to pass a bunch of parameters to an API call. Ideally APIs should be closely factored to accept single parameters or a single content parameter at least along with some identifier parameters that can be passed on the querystring. But saying that doesn't mean that occasionally you don't run into a situation where you have the need to pass several objects to the server and all three of the options I mentioned might have merit in different situations. For now I'm sure the question of how to pass multiple parameters will come up quite a bit from people migrating WCF REST or ASP.NET AJAX code to Web API. At least there are options available to make it work.© Rick Strahl, West Wind Technologies, 2005-2012Posted in Web Api   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Elfsign Object Signing on Solaris

    - by danx
    Elfsign Object Signing on Solaris Don't let this happen to you—use elfsign! Solaris elfsign(1) is a command that signs and verifies ELF format executables. That includes not just executable programs (such as ls or cp), but other ELF format files including libraries (such as libnvpair.so) and kernel modules (such as autofs). Elfsign has been available since Solaris 10 and ELF format files distributed with Solaris, since Solaris 10, are signed by either Sun Microsystems or its successor, Oracle Corporation. When an ELF file is signed, elfsign adds a new section the ELF file, .SUNW_signature, that contains a RSA public key signature and other information about the signer. That is, the algorithm used, algorithm OID, signer CN/OU, and time stamp. The signature section can later be verified by elfsign or other software by matching the signature in the file agains the ELF file contents (excluding the signature). ELF executable files may also be signed by a 3rd-party or by the customer. This is useful for verifying the origin and authenticity of executable files installed on a system. The 3rd-party or customer public key certificate should be installed in /etc/certs/ to allow verification by elfsign. For currently-released versions of Solaris, only cryptographic framework plugin libraries are verified by Solaris. However, all ELF files may be verified by the elfsign command at any time. Elfsign Algorithms Elfsign signatures are created by taking a digest of the ELF section contents, then signing the digest with RSA. To verify, one takes a digest of ELF file and compares with the expected digest that's computed from the signature and RSA public key. Originally elfsign took a MD5 digest of a SHA-1 digest of the ELF file sections, then signed the resulting digest with RSA. In Solaris 11.1 then Solaris 11.1 SRU 7 (5/2013), the elfsign crypto algorithms available have been expanded to keep up with evolving cryptography. The following table shows the available elfsign algorithms: Elfsign Algorithm Solaris Release Comments elfsign sign -F rsa_md5_sha1   S10, S11.0, S11.1 Default for S10. Not recommended* elfsign sign -F rsa_sha1 S11.1 Default for S11.1. Not recommended elfsign sign -F rsa_sha256 S11.1 patch SRU7+   Recommended ___ *Most or all CAs do not accept MD5 CSRs and do not issue MD5 certs due to MD5 hash collision problems. RSA Key Length. I recommend using RSA-2048 key length with elfsign is RSA-2048 as the best balance between a long expected "life time", interoperability, and performance. RSA-2048 keys have an expected lifetime through 2030 (and probably beyond). For details, see Recommendation for Key Management: Part 1: General, NIST Publication SP 800-57 part 1 (rev. 3, 7/2012, PDF), tables 2 and 4 (pp. 64, 67). Step 1: create or obtain a key and cert The first step in using elfsign is to obtain a key and cert from a public Certificate Authority (CA), or create your own self-signed key and cert. I'll briefly explain both methods. Obtaining a Certificate from a CA To obtain a cert from a CA, such as Verisign, Thawte, or Go Daddy (to name a few random examples), you create a private key and a Certificate Signing Request (CSR) file and send it to the CA, following the instructions of the CA on their website. They send back a signed public key certificate. The public key cert, along with the private key you created is used by elfsign to sign an ELF file. The public key cert is distributed with the software and is used by elfsign to verify elfsign signatures in ELF files. You need to request a RSA "Class 3 public key certificate", which is used for servers and software signing. Elfsign uses RSA and we recommend RSA-2048 keys. The private key and CSR can be generated with openssl(1) or pktool(1) on Solaris. Here's a simple example that uses pktool to generate a private RSA_2048 key and a CSR for sending to a CA: $ pktool gencsr keystore=file format=pem outcsr=MYCSR.p10 \ subject="CN=canineswworks.com,OU=Canine SW object signing" \ outkey=MYPRIVATEKEY.key $ openssl rsa -noout -text -in MYPRIVATEKEY.key Private-Key: (2048 bit) modulus: 00:d2:ef:42:f2:0b:8c:96:9f:45:32:fc:fe:54:94: . . . [omitted for brevity] . . . c9:c7 publicExponent: 65537 (0x10001) privateExponent: 26:14:fc:49:26:bc:a3:14:ee:31:5e:6b:ac:69:83: . . . [omitted for brevity] . . . 81 prime1: 00:f6:b7:52:73:bc:26:57:26:c8:11:eb:6c:dc:cb: . . . [omitted for brevity] . . . bc:91:d0:40:d6:9d:ac:b5:69 prime2: 00:da:df:3f:56:b2:18:46:e1:89:5b:6c:f1:1a:41: . . . [omitted for brevity] . . . f3:b7:48:de:c3:d9:ce:af:af exponent1: 00:b9:a2:00:11:02:ed:9a:3f:9c:e4:16:ce:c7:67: . . . [omitted for brevity] . . . 55:50:25:70:d3:ca:b9:ab:99 exponent2: 00:c8:fc:f5:57:11:98:85:8e:9a:ea:1f:f2:8f:df: . . . [omitted for brevity] . . . 23:57:0e:4d:b2:a0:12:d2:f5 coefficient: 2f:60:21:cd:dc:52:76:67:1a:d8:75:3e:7f:b0:64: . . . [omitted for brevity] . . . 06:94:56:d8:9d:5c:8e:9b $ openssl req -noout -text -in MYCSR.p10 Certificate Request: Data: Version: 2 (0x2) Subject: OU=Canine SW object signing, CN=canineswworks.com Subject Public Key Info: Public Key Algorithm: rsaEncryption Public-Key: (2048 bit) Modulus: 00:d2:ef:42:f2:0b:8c:96:9f:45:32:fc:fe:54:94: . . . [omitted for brevity] . . . c9:c7 Exponent: 65537 (0x10001) Attributes: Signature Algorithm: sha1WithRSAEncryption b3:e8:30:5b:88:37:68:1c:26:6b:45:af:5e:de:ea:60:87:ea: . . . [omitted for brevity] . . . 06:f9:ed:b4 Secure storage of RSA private key. The private key needs to be protected if the key signing is used for production (as opposed to just testing). That is, protect the key to protect against unauthorized signatures by others. One method is to use a PIN-protected PKCS#11 keystore. The private key you generate should be stored in a secure manner, such as in a PKCS#11 keystore using pktool(1). Otherwise others can sign your signature. Other secure key storage mechanisms include a SCA-6000 crypto card, a USB thumb drive stored in a locked area, a dedicated server with restricted access, Oracle Key Manager (OKM), or some combination of these. I also recommend secure backup of the private key. Here's an example of generating a private key protected in the PKCS#11 keystore, and a CSR. $ pktool setpin # use if PIN not set yet Enter token passphrase: changeme Create new passphrase: Re-enter new passphrase: Passphrase changed. $ pktool gencsr keystore=pkcs11 label=MYPRIVATEKEY \ format=pem outcsr=MYCSR.p10 \ subject="CN=canineswworks.com,OU=Canine SW object signing" $ pktool list keystore=pkcs11 Enter PIN for Sun Software PKCS#11 softtoken: Found 1 asymmetric public keys. Key #1 - RSA public key: MYPRIVATEKEY Here's another example that uses openssl instead of pktool to generate a private key and CSR: $ openssl genrsa -out cert.key 2048 $ openssl req -new -key cert.key -out MYCSR.p10 Self-Signed Cert You can use openssl or pktool to create a private key and a self-signed public key certificate. A self-signed cert is useful for development, testing, and internal use. The private key created should be stored in a secure manner, as mentioned above. The following example creates a private key, MYSELFSIGNED.key, and a public key cert, MYSELFSIGNED.pem, using pktool and displays the contents with the openssl command. $ pktool gencert keystore=file format=pem serial=0xD06F00D lifetime=20-year \ keytype=rsa hash=sha256 outcert=MYSELFSIGNED.pem outkey=MYSELFSIGNED.key \ subject="O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com" $ pktool list keystore=file objtype=cert infile=MYSELFSIGNED.pem Found 1 certificates. 1. (X.509 certificate) Filename: MYSELFSIGNED.pem ID: c8:24:59:08:2b:ae:6e:5c:bc:26:bd:ef:0a:9c:54:de:dd:0f:60:46 Subject: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com Issuer: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com Not Before: Oct 17 23:18:00 2013 GMT Not After: Oct 12 23:18:00 2033 GMT Serial: 0xD06F00D0 Signature Algorithm: sha256WithRSAEncryption $ openssl x509 -noout -text -in MYSELFSIGNED.pem Certificate: Data: Version: 3 (0x2) Serial Number: 3496935632 (0xd06f00d0) Signature Algorithm: sha256WithRSAEncryption Issuer: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com Validity Not Before: Oct 17 23:18:00 2013 GMT Not After : Oct 12 23:18:00 2033 GMT Subject: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com Subject Public Key Info: Public Key Algorithm: rsaEncryption Public-Key: (2048 bit) Modulus: 00:bb:e8:11:21:d9:4b:88:53:8b:6c:5a:7a:38:8b: . . . [omitted for brevity] . . . bf:77 Exponent: 65537 (0x10001) Signature Algorithm: sha256WithRSAEncryption 9e:39:fe:c8:44:5c:87:2c:8f:f4:24:f6:0c:9a:2f:64:84:d1: . . . [omitted for brevity] . . . 5f:78:8e:e8 $ openssl rsa -noout -text -in MYSELFSIGNED.key Private-Key: (2048 bit) modulus: 00:bb:e8:11:21:d9:4b:88:53:8b:6c:5a:7a:38:8b: . . . [omitted for brevity] . . . bf:77 publicExponent: 65537 (0x10001) privateExponent: 0a:06:0f:23:e7:1b:88:62:2c:85:d3:2d:c1:e6:6e: . . . [omitted for brevity] . . . 9c:e1:e0:0a:52:77:29:4a:75:aa:02:d8:af:53:24: c1 prime1: 00:ea:12:02:bb:5a:0f:5a:d8:a9:95:b2:ba:30:15: . . . [omitted for brevity] . . . 5b:ca:9c:7c:19:48:77:1e:5d prime2: 00:cd:82:da:84:71:1d:18:52:cb:c6:4d:74:14:be: . . . [omitted for brevity] . . . 5f:db:d5:5e:47:89:a7:ef:e3 exponent1: 32:37:62:f6:a6:bf:9c:91:d6:f0:12:c3:f7:04:e9: . . . [omitted for brevity] . . . 97:3e:33:31:89:66:64:d1 exponent2: 00:88:a2:e8:90:47:f8:75:34:8f:41:50:3b:ce:93: . . . [omitted for brevity] . . . ff:74:d4:be:f3:47:45:bd:cb coefficient: 4d:7c:09:4c:34:73:c4:26:f0:58:f5:e1:45:3c:af: . . . [omitted for brevity] . . . af:01:5f:af:ad:6a:09:bf Step 2: Sign the ELF File object By now you should have your private key, and obtained, by hook or crook, a cert (either from a CA or use one you created (a self-signed cert). The next step is to sign one or more objects with your private key and cert. Here's a simple example that creates an object file, signs, verifies, and lists the contents of the ELF signature. $ echo '#include <stdio.h>\nint main(){printf("Hello\\n");}'>hello.c $ make hello cc -o hello hello.c $ elfsign verify -v -c MYSELFSIGNED.pem -e hello elfsign: no signature found in hello. $ elfsign sign -F rsa_sha256 -v -k MYSELFSIGNED.key -c MYSELFSIGNED.pem -e hello elfsign: hello signed successfully. format: rsa_sha256. signer: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com. signed on: October 17, 2013 04:22:49 PM PDT. $ elfsign list -f format -e hello rsa_sha256 $ elfsign list -f signer -e hello O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com $ elfsign list -f time -e hello October 17, 2013 04:22:49 PM PDT $ elfsign verify -v -c MYSELFSIGNED.key -e hello elfsign: verification of hello failed. format: rsa_sha256. signer: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com. signed on: October 17, 2013 04:22:49 PM PDT. Signing using the pkcs11 keystore To sign the ELF file using a private key in the secure pkcs11 keystore, replace "-K MYSELFSIGNED.key" in the "elfsign sign" command line with "-T MYPRIVATEKEY", where MYPRIVATKEY is the pkcs11 token label. Step 3: Install the cert and test on another system Just signing the object isn't enough. You need to copy or install the cert and the signed ELF file(s) on another system to test that the signature is OK. Your public key cert should be installed in /etc/certs. Use elfsign verify to verify the signature. Elfsign verify checks each cert in /etc/certs until it finds one that matches the elfsign signature in the file. If one isn't found, the verification fails. Here's an example: $ su Password: # rm /etc/certs/MYSELFSIGNED.key # cp MYSELFSIGNED.pem /etc/certs # exit $ elfsign verify -v hello elfsign: verification of hello passed. format: rsa_sha256. signer: O=Canine Software Works, OU=Self-signed CA, CN=canineswworks.com. signed on: October 17, 2013 04:24:20 PM PDT. After testing, package your cert along with your ELF object to allow elfsign verification after your cert and object are installed or copied. Under the Hood: elfsign verification Here's the steps taken to verify a ELF file signed with elfsign. The steps to sign the file are similar except the private key exponent is used instead of the public key exponent and the .SUNW_signature section is written to the ELF file instead of being read from the file. Generate a digest (SHA-256) of the ELF file sections. This digest uses all ELF sections loaded in memory, but excludes the ELF header, the .SUNW_signature section, and the symbol table Extract the RSA signature (RSA-2048) from the .SUNW_signature section Extract the RSA public key modulus and public key exponent (65537) from the public key cert Calculate the expected digest as follows:     signaturepublicKeyExponent % publicKeyModulus Strip the PKCS#1 padding (most significant bytes) from the above. The padding is 0x00, 0x01, 0xff, 0xff, . . ., 0xff, 0x00. If the actual digest == expected digest, the ELF file is verified (OK). Further Information elfsign(1), pktool(1), and openssl(1) man pages. "Signed Solaris 10 Binaries?" blog by Darren Moffat (2005) shows how to use elfsign. "Simple CLI based CA on Solaris" blog by Darren Moffat (2008) shows how to set up a simple CA for use with self-signed certificates. "How to Create a Certificate by Using the pktool gencert Command" System Administration Guide: Security Services (available at docs.oracle.com)

    Read the article

  • CodePlex Daily Summary for Tuesday, February 08, 2011

    CodePlex Daily Summary for Tuesday, February 08, 2011Popular ReleasesyoutubeFisher: youtubeFisher 3.0 [beta]: What's new: Supports YouTube's new layout Complete internal refactoringNearforums - ASP.NET MVC forum engine: Nearforums v5.0: Version 5.0 of the ASP.NET MVC Forum Engine, containing the following improvements: .NET 4.0 as target framework using ASP.NET MVC 3. All views migrated to Razor for cleaner markup. Alternate template (Layout file) for mobile devices 4 Bug Fixes since Version 4.1 Visit the project Roadmap for more details.fuv: 1.0 release, codename Chopper Joe: features: search/replace :o to open file :s to save file :q to quitASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.7: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager html generation optimized new features for the lookup (add additional search data ) live demo went aeroEnhSim: EnhSim 2.3.6 BETA: 2.3.6 BETAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 Changes since 2.3.0 ...TestApi - a library of Test APIs: TestApi v0.6: TestApi v0.6 comes with the following changes: TestApi code development has been moved to Codeplex: Moved TestApi soluton to VS 2010; Moved all source code to Codeplex. All development work is done there now. Fault Injection API: Integrated the unmanaged FaultInjectionEngine.dll COM component in the build; Cleaned up FaultInjectionEngine.dll to build at warning level 4; Implemented “FaultScope” which allows for in-process fault injection; Added automation scripts & sample program; ...AutoLoL: AutoLoL v1.5.5: AutoChat now allows up to 6 items. Items with nr. 7-0 will be removed! News page url's are now opened in the default browser Added a context menu to the system tray icon (thanks to Alex Banagos) AutoChat now allows configuring the Chat Keys and the Modifier Key The recent files list now supports compact and full mode Fix: Swapped mouse buttons are now properly detected Fix: Sometimes the Play button was pressed while still greyed out Champion: Karma Note: You can also run the u...mojoPortal: 2.3.6.2: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2362-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Rawr: Rawr 4.0.19 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you have a problem, please follow the Posting Guidelines and put it into the Issue Trac...IronRuby: 1.1.2: IronRuby 1.1.2 is a servicing release that keeps on improving compatibility with Ruby 1.9.2 and includes IronRuby integration to Visual Studio 2010. We decided to drop 1.8.6 compatibility mode in all post-1.0 releases. We recommend using IronRuby 1.0 if you need 1.8.6 compatibility. In this release we fixed several major issues: - problems that blocked Gem installation in certain cases - regex syntax: the parser was replaced with a new one that is much more compatible with Ruby 1.9.2 - cras...Pyxis 2: Production Release: Pyxis 2.0.0.13 - Full Production Release This release of Pyxis 2 offers you a wide range of features: Launch Applications in their own threads & domains Render alpha-blended icons on the desktop Support for SD & USB drives Online App Store Dynamic & Static IP support Menus & Modals Over a dozen GUI controls File selection dialogs Folder selection dialog Application, Bootloader, and Firmware Updating Update Release Notes Much More!Microsoft All-In-One Code Framework: Sample Browser v2 (CTP Release): Sample Browser v2 (CTP Release) http://i3.codeplex.com/Project/Download/FileDownload.aspx?ProjectName=1code&DownloadId=205917MVVM Light Toolkit: MVVM Light Toolkit V3 SP1 (4): There was a small issue with the previous release that caused errors when installing the templates in VS10 Express. This release corrects the error. Only use this if you encountered issues when installing the previous release. No changes in the binaries.Finestra Virtual Desktops: 1.0: Finally the version 1.0 release! Sorry for the long delay since the last release, but I think that you'll find this release to be really smooth, really stable, and a really great enhancement to Windows. New features include: Windows 7 taskbar integration Major performance and usability improvements Redesigned look and feel New name: Finestra Better automatic updating Much faster full-screen switcher Fixes Windows 7 hotkey collisions by default Updated installerFacebook C# SDK: 5.0.2 (BETA): PLEASE TAKE A FEW MINUTES TO GIVE US SOME FEEDBACK: Facebook C# SDK Survey This is third BETA release of the version 5 branch of the Facebook C# SDK. Remember this is a BETA build. Some things may change or not work exactly as planned. We are absolutely looking for feedback on this release to help us improve the final 5.X.X release. This release contains some breaking changes. Particularly with authentication. After spending time reviewing the trouble areas that people are having using th...ASP.NET MVC SiteMap provider: MvcSiteMapProvider 3.0.0 for MVC3: Using NuGet?MvcSiteMapProvider is also listed in the NuGet feed. Learn more... Like the project? Consider a donation!Donate via PayPal via PayPal. ChangelogTargeting ASP.NET MVC 3 and .NET 4.0 Additional UpdatePriority options for generating XML sitemaps Allow to specify target on SiteMapTitleAttribute One action with multiple routes and breadcrumbs Medium Trust optimizations Create SiteMapTitleAttribute for setting parent title IntelliSense for your sitemap with MvcSiteMapSchem...patterns & practices SharePoint Guidance: SharePoint Guidance 2010 Hands On Lab: SharePoint Guidance 2010 Hands On Lab consists of six labs: one for logging, one for service location, and four for application setting manager. Each lab takes about 20 minutes to walk through. Each lab consists of a PDF document. You can go through the steps in the doc to create solution and then build/deploy the solution and run the lab. For those of you who wants to save the time, we included the final solution so you can just build/deploy the solution and run the lab.Value Injecter - object(s) to -> object mapper: 2.3: it lets you define your own convention-based matching algorithms (ValueInjections) in order to match up (inject) source values to destination values. inject from multiple sources in one InjectFrom added ConventionInjectionMobile Device Detection and Redirection: 0.1.11.11: Improvements to Beta Release The following changes have been made in version 0.1.11.11: BlackBerry Version 6 devices (such as the 9800 Torch) are now correctly identified with a dedicated handler. Android powered devices are now correctly identified. Minor change to Provider.cs to improve performance and optimise data sent to 51Degrees.mobi if the option is enabled. GC.collect is no longer called at any point. All garbage collection now happens automatically IMPORTANT CHANGES This rele...TweetSharp: TweetSharp v2.0.0.0 - Preview 10: Documentation for this release may be found at http://tweetsharp.codeplex.com/wikipage?title=UserGuide&referringTitle=Documentation. Note: This code is currently preview quality. Preview 9 ChangesAdded support for trends Added support for Silverlight 4 Elevated WP7 fixes Third Party Library VersionsHammock v1.1.7: http://hammock.codeplex.com Json.NET 4.0 Release 1: http://json.codeplex.comNew Projectsbisolu_sendus: bisolu smsBlack & Scholes: Black & Scholes OptionsCosLabs: CosLabs makes it easy to see the full capabilities of the Cosmos operating system toolkit. CosLabs has a number of experiments to find new and unique uses for Cosmos. It's developed in C#.DeployToAzure: DeployToAzure allows automating deployment of Windows Azure project and making it a part of TFS 2010 build process without using PowerShell and Azure Management CmdLets. Digital: Educational purposesDiscogsNet: DiscogsNet is a .NET library to query the Discogs.com API and parse the Discogs XML data dump files. It's developed in C# and usable from any .NET language. The API of the library is focused on ease of use and intuitiveness.DJME - The jQuery extensions for ASP.NET MVC: DJME - The jQuery extensions for ASP.NET MVC is a lightweight framework which helps you build rich user interfaces for ASP.NET MVC while enjoying great developer productivity. DokuDB: Visio AddIn to document different versions of a databaseDtsConfig Explorer: This project is a windows froms application that helps explore a SSIS dtsconfig file with an easy wayEveryDNS Service: Windows service to automatically send your current IP address to everydns.net for dynamic domains. Automatically monitors and sends IP address changes without having to be logged in. The project is built in C# targeting the .NET 4.0 framework.EvoSim - Evolution Simulation: EvoSim is a pet project to learn aspects of MVVM, WPF/Silverlight, and Parallel Processing features of .NET 4. The goal is to simulate a world filled with creatures that move, eat, reproduce, and die according to Darwinian evolutionary principles. It is tile and turn based.EZStorage: A storage library for XNA based on EasyStorage but abstracting in an XML based file list for each folder, allowing file listings on all folders and details like file creation dates which are no longer possible in XNA 4.0ForeverBell's Snake: A snake game written in VB.NET.Glauca Browser: This is a browser with a webkit core inside.Grauers SharePoint 2010 Custom MasterPage Feature: This is a SharePoint 2010 Custom MastePage feature. Custom Master and custom CSS Blog post about the project: http://www.grauers.net/archive/2011/02/07/build-a-sharepoint-2010-custom-mastepage-with-visual-studio-2010.aspxHamming Code Sample: HamCode demonstrate how the hamming code work, result of coded and decoded data. Shows the benefits of hamming method/codeHydroDesktop Mercurial Test: This is a trial version of the HydroDesktop project (hydrodesktop.codeplex.com) running on Mercurial source code repository. We first want to test whether the data update/download is happening fine before switching the official HydroDesktop website to the new system.LateBindingApi: Creates .Net Proxy Components from COM Type Libraries.Middlesex County College Library Wireless Auto Login: The Middlesex County College Library Wireless Auto Login automatically logs a computer in to the Middlesex County College (Edison, NJ) Library's WifiMobility: Mobility is a small program that reads from a text file. The text file includes everything about the program, right down to that cute little bunny on your desktop! Try Mobility today!OpenMFC: OpenMFC is opensource version of MFC for using with C/C++ compiler without MFC.Orchard Content Sharing: This Orchard module adds content sharing functionality via integration with AddThis.com sharing service.Orchard Wunder Weather Widget: This project is used to maintain the source code for the Wunder Weather widget in the Orchard gallery.Professional Audio Recorder: Professional Audio Recorder is a Audio Recorder for Windows Phone 7Python Node Info for Umbraco: Designed to assist Umbraco macro authors who are writing their macros in Python. Provides a helper macro that, when inserted into a page, will enable the display of an info panel showing the page node properties as represented in Python.Softina.Graphs: Softina.Graphs is a graph managment and algorithm utility. It includes a set of libraries to work with graph processing. It is written using .net framework with c# language and MS Visual Studio 2008. Client applications is created using devexpress components.spangesharp: Application to help people learn c#Visual Studio Private Extension Gallery: Add a new tab in the Visual Studio extension manager to manage private extensions.WCF Home Framework: Home Framework is a service-oriented framework able to facilitate deploy and management of wcf services in a mid-size scenario project.Windows Phone 7 Video Player: This project contains all the source of an application for Windows Phone 7 to consume an RSS Media exposed by our Smooth Streaming Video Player plugin for WordPress (http://smooth.codeplex.com).WOL Shopping List: This is a shoppingList version of WOL's NearMeWP7RSSReader: Updated RSSReader project for Windows Phone 7 using the RTM tools with the October 2010 update.Xen (XNA Extended) Framework: The Xen Framework is a set of libraries that provides and extends XNA 4.0 functionality to make game development easier and faster while producing clean, maintainable code. Xen frees you up to spend more time building your game.

    Read the article

  • Introducing Data Annotations Extensions

    - by srkirkland
    Validation of user input is integral to building a modern web application, and ASP.NET MVC offers us a way to enforce business rules on both the client and server using Model Validation.  The recent release of ASP.NET MVC 3 has improved these offerings on the client side by introducing an unobtrusive validation library built on top of jquery.validation.  Out of the box MVC comes with support for Data Annotations (that is, System.ComponentModel.DataAnnotations) and can be extended to support other frameworks.  Data Annotations Validation is becoming more popular and is being baked in to many other Microsoft offerings, including Entity Framework, though with MVC it only contains four validators: Range, Required, StringLength and Regular Expression.  The Data Annotations Extensions project attempts to augment these validators with additional attributes while maintaining the clean integration Data Annotations provides. A Quick Word About Data Annotations Extensions The Data Annotations Extensions project can be found at http://dataannotationsextensions.org/, and currently provides 11 additional validation attributes (ex: Email, EqualTo, Min/Max) on top of Data Annotations’ original 4.  You can find a current list of the validation attributes on the afore mentioned website. The core library provides server-side validation attributes that can be used in any .NET 4.0 project (no MVC dependency). There is also an easily pluggable client-side validation library which can be used in ASP.NET MVC 3 projects using unobtrusive jquery validation (only MVC3 included javascript files are required). On to the Preview Let’s say you had the following “Customer” domain model (or view model, depending on your project structure) in an MVC 3 project: public class Customer { public string Email { get; set; } public int Age { get; set; } public string ProfilePictureLocation { get; set; } } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } When it comes time to create/edit this Customer, you will probably have a CustomerController and a simple form that just uses one of the Html.EditorFor() methods that the ASP.NET MVC tooling generates for you (or you can write yourself).  It should look something like this: With no validation, the customer can enter nonsense for an email address, and then can even report their age as a negative number!  With the built-in Data Annotations validation, I could do a bit better by adding a Range to the age, adding a RegularExpression for email (yuck!), and adding some required attributes.  However, I’d still be able to report my age as 10.75 years old, and my profile picture could still be any string.  Let’s use Data Annotations along with this project, Data Annotations Extensions, and see what we can get: public class Customer { [Email] [Required] public string Email { get; set; }   [Integer] [Min(1, ErrorMessage="Unless you are benjamin button you are lying.")] [Required] public int Age { get; set; }   [FileExtensions("png|jpg|jpeg|gif")] public string ProfilePictureLocation { get; set; } } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } Now let’s try to put in some invalid values and see what happens: That is very nice validation, all done on the client side (will also be validated on the server).  Also, the Customer class validation attributes are very easy to read and understand. Another bonus: Since Data Annotations Extensions can integrate with MVC 3’s unobtrusive validation, no additional scripts are required! Now that we’ve seen our target, let’s take a look at how to get there within a new MVC 3 project. Adding Data Annotations Extensions To Your Project First we will File->New Project and create an ASP.NET MVC 3 project.  I am going to use Razor for these examples, but any view engine can be used in practice.  Now go into the NuGet Extension Manager (right click on references and select add Library Package Reference) and search for “DataAnnotationsExtensions.”  You should see the following two packages: The first package is for server-side validation scenarios, but since we are using MVC 3 and would like comprehensive sever and client validation support, click on the DataAnnotationsExtensions.MVC3 project and then click Install.  This will install the Data Annotations Extensions server and client validation DLLs along with David Ebbo’s web activator (which enables the validation attributes to be registered with MVC 3). Now that Data Annotations Extensions is installed you have all you need to start doing advanced model validation.  If you are already using Data Annotations in your project, just making use of the additional validation attributes will provide client and server validation automatically.  However, assuming you are starting with a blank project I’ll walk you through setting up a controller and model to test with. Creating Your Model In the Models folder, create a new User.cs file with a User class that you can use as a model.  To start with, I’ll use the following class: public class User { public string Email { get; set; } public string Password { get; set; } public string PasswordConfirm { get; set; } public string HomePage { get; set; } public int Age { get; set; } } Next, create a simple controller with at least a Create method, and then a matching Create view (note, you can do all of this via the MVC built-in tooling).  Your files will look something like this: UserController.cs: public class UserController : Controller { public ActionResult Create() { return View(new User()); }   [HttpPost] public ActionResult Create(User user) { if (!ModelState.IsValid) { return View(user); }   return Content("User valid!"); } } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } Create.cshtml: @model NuGetValidationTester.Models.User   @{ ViewBag.Title = "Create"; }   <h2>Create</h2>   <script src="@Url.Content("~/Scripts/jquery.validate.min.js")" type="text/javascript"></script> <script src="@Url.Content("~/Scripts/jquery.validate.unobtrusive.min.js")" type="text/javascript"></script>   @using (Html.BeginForm()) { @Html.ValidationSummary(true) <fieldset> <legend>User</legend> @Html.EditorForModel() <p> <input type="submit" value="Create" /> </p> </fieldset> } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } In the Create.cshtml view, note that we are referencing jquery validation and jquery unobtrusive (jquery is referenced in the layout page).  These MVC 3 included scripts are the only ones you need to enjoy both the basic Data Annotations validation as well as the validation additions available in Data Annotations Extensions.  These references are added by default when you use the MVC 3 “Add View” dialog on a modification template type. Now when we go to /User/Create we should see a form for editing a User Since we haven’t yet added any validation attributes, this form is valid as shown (including no password, email and an age of 0).  With the built-in Data Annotations attributes we can make some of the fields required, and we could use a range validator of maybe 1 to 110 on Age (of course we don’t want to leave out supercentenarians) but let’s go further and validate our input comprehensively using Data Annotations Extensions.  The new and improved User.cs model class. { [Required] [Email] public string Email { get; set; }   [Required] public string Password { get; set; }   [Required] [EqualTo("Password")] public string PasswordConfirm { get; set; }   [Url] public string HomePage { get; set; }   [Integer] [Min(1)] public int Age { get; set; } } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } Now let’s re-run our form and try to use some invalid values: All of the validation errors you see above occurred on the client, without ever even hitting submit.  The validation is also checked on the server, which is a good practice since client validation is easily bypassed. That’s all you need to do to start a new project and include Data Annotations Extensions, and of course you can integrate it into an existing project just as easily. Nitpickers Corner ASP.NET MVC 3 futures defines four new data annotations attributes which this project has as well: CreditCard, Email, Url and EqualTo.  Unfortunately referencing MVC 3 futures necessitates taking an dependency on MVC 3 in your model layer, which may be unadvisable in a multi-tiered project.  Data Annotations Extensions keeps the server and client side libraries separate so using the project’s validation attributes don’t require you to take any additional dependencies in your model layer which still allowing for the rich client validation experience if you are using MVC 3. Custom Error Message and Globalization: Since the Data Annotations Extensions are build on top of Data Annotations, you have the ability to define your own static error messages and even to use resource files for very customizable error messages. Available Validators: Please see the project site at http://dataannotationsextensions.org/ for an up-to-date list of the new validators included in this project.  As of this post, the following validators are available: CreditCard Date Digits Email EqualTo FileExtensions Integer Max Min Numeric Url Conclusion Hopefully I’ve illustrated how easy it is to add server and client validation to your MVC 3 projects, and how to easily you can extend the available validation options to meet real world needs. The Data Annotations Extensions project is fully open source under the BSD license.  Any feedback would be greatly appreciated.  More information than you require, along with links to the source code, is available at http://dataannotationsextensions.org/. Enjoy!

    Read the article

  • CodePlex Daily Summary for Thursday, April 01, 2010

    CodePlex Daily Summary for Thursday, April 01, 2010New ProjectsASP.NET Bing Maps: Extensible and easy to use, this is ASP.NET Bing Maps Control. Drag & Drop and is ready to go. You can configure map mode, map style, add a PushPin...Bricks' Bane: Bricks' Bane is a brick breaker game developed using XNA and published on XBox Live Indy Games. Source code includes a C# library useful for game d...cURL for dotnet: Another dotnet binding for libcurl see http://curl.haxx.se for more info about cURL/libcurlCustom Functoid que acessa o banco de dados SQL: Functoid para Biztalk Server 2006 utilizando dados do SQL Server 2005FEI STU Pharmacy e-shop: Elektronicky obchod s liekmi Vytvorte jednoduchú klient-server aplikáciu, ktorá bude realizovať elektronický obchod s liekmi. Moduly: 1. e-shop f...Flavours of Wix: Investigating building DSL's to create installers based on WIXFulcrum: Fulcrum is a code generation framework built on top of the T4 technology in Visual Studio. GreviousAngel: New team projectHabanero Inferno: Habanero Inferno coming soon.Kawo Pounga !: A useless game !!!LetsXNA!!: This is a project created by members of Linked In group Lets XNA!! to build a XNA game and have fun in the process. The goal is to build a simple ...Linq To Naver , Custom Linq Provider for Naver searchengine OpenAPI: <project name>Linq to Naver </project name> <programming language>C#, CSharp</programming language>LocoSync: LocoSync is a file Syncronization/Backup/Archiver program, which is easily extendable. It is easy to add new syncronization methods using C# code.Natural Language Processing: Natural Language ProcessingNop Commerce Azure: Ce projet vous permet de mettre en place rapidement et simplement votre site d'e-commerce en ligne en bénéficiant de tous les avantages de la plate...Nwinsock: Nwinsock is a component for network , Object Transfer, Pocket Compression, Support TCP,UDP Protocol, Thread Base OnTime: OnTime is a simple program from that matching game back in the day just to bring light to programming techniques. It's developed in C#.?OpenGL ES 2.0 Compact Framework Wrapper: OpenGL ES 2.0 wrapper for .NET Compact Framework. Developed on HTC HD 2 device but should run on any Windows Mobile device that has the correct lib...ortaknokta: bu proje: birkaç kişinin bir araya gelip, istedikleri konularda tartışma yapmalarına olanak saglamak icin hazırlanmaya çalışıl maktadır. P-Data: P-Data es una herramienta que permite obtener información procedente de archivos de datos (Data Profiling) a través de consultas SQL, automatizando...PowerAuras: Addon for World of Warcraft - Displays effects on screen at different conditionsPowerShell ToodleDo Module: PowerShell Module for interacting with toodledo.com online To-Do list site. RSS Reader for Windows Phone 7: This RSS Reader application for windows 7Streamlet Containers: This is my implement of STL-style containers, including a dynamic array, a double-linked list and an r-b-tree. Just for practice. Please feel free...Troav: Social encyclopedia built using c# and the Orchard frameworkUmbraco App_Code/Usercontrol Editor: Package for Umbraco to add App_Code and usercontrol editing to the Developer section of the Umbraco administration system. Will support GeSHi editi...Vczh Reactive Programming Library: Reactive programming library provide a stream or state machine view to use .NET eventsWhoIs XML API: The project uses the public WhoIs XML API service (http://www.whoisxmlapi.com/) to obtain detailed details. The project is written in C# and serial...WPF FlowDocument Examples for VS2008 and VS2010: WPF Text Samples (especially FlowDocument) on the various possible effects: sub- and super-script, ruby (a.k.a. furigana), and various others...You are here (for Windows Mobile): This sample shows you how to play a *.wav file on your device with Compact Framework 2.0. There is better support for playing music on Compact F...New Releases( λunula ): Lunula 0.4.0: Changelog Implemented a virtual machine. Implemented a compiler for the virtual machine. Added first-class continuations (call/cc) Removed co...Alter gear SQL index Management: Setup 1.0.1: Changes Test connection - successful message Connection string timeout property added Setup Project added to project source code Possible issu...ASP.NET Bing Maps: ASP.NET Bing Maps 0.1b: Project Description Extensible and easy to use, this is ASP.NET Bing Maps Control. Drag & Drop and is ready to go. You can configure map mode, map ...ASP.NET MVC Validation Library: ASP.NET MVC Validation Library 1.3: Changes since 1.2: - Support remote validation - Support custom server-side validation - The design of validation attribute is improved Note: test...BigDays 2010: HelfenHelfen - v1: PLEASE NOTE: This project is published under the Microsoft Public License (Ms-PL). http://bigdays10.codeplex.com/license IT IS A DEMO SOLUTION FOR...Caps - Manage your collection!: Caps Console 0.1.4.0 Alpha: This is preview release (Alpha quality). This release contains only limited amount of fixes and new features from user point of view. Major focus f...CSharpQuery: Version 1.0: This version is stable. Please report any possible bugs. The next release will include a sample project and index management tools. Until then pl...Custom Functoid que acessa o banco de dados SQL: Custom Functoid SQL Server: Solução do Visual Studio com código fonte e script SQL do functoid em BiztalkDawf: Dual Audio Workflow: Beta 3: Suppose if two good audio events overlap in time with a videoevent of interest. (This can only happen if PluralEyes isn't used on everything). Befo...Dirac codec user interface: Dirac User Interface (checkin 37132): Same as 36795 version, but done with the last source code.DotNetNuke® Blog: 04.00.00 RC 3: PLEASE NOTE: You may upgrade an RC 2 install. But please do not upgrade previous version of the Beta releases - please start from RC 2 or 03.05.0...DotNetNuke® Skinning Extensions: SimpleTitle Skin Object: This is an example skin object that only renders the "page name" if used in a skin and the "module title" if used in a container. No extra spans, c...Fulcrum: Fulcrum v0.9: Initial release of FulcrumHelloTipi Photos Uploader: Version 2010.03.31: De toute petites corrections : - Correction du bouton envoyer - Impossible d'interagir avec l'application quand on uploadkdar: KDAR 0.0.18: KDAR - Kernel Debugger Anti Rootkit - dispacth table's signature bases updated ( many driver's) - scripts refactored - some bug fixedLegend: Legend Libraries: The latest release.Linq To Naver , Custom Linq Provider for Naver searchengine OpenAPI: Linq to Naver: Linq to NaverLive at Education Meta Web-Service: Live at Education Meta Web Service v. 1.0: We're happy to publish final version of Live at Education Meta Web Serivce (LAEMWS). In this release: Huge list of Windows Live ID enabled servic...Live@edu SSO WebPart for MOSS 2007: WebPart 2.0: This release is based on Live@edu Meta Web Service (laemws - http://laemws.codeplex.com). It is highly recomended to use laemws version of webpart,...LocoSync: LocoSync v0.1r2010.03.31 installer: This is the first public release. Unzip and run setup. Or if you have .net 3.5 runtime available download the exetutable and try...Natural Language Processing: test1: testNop Commerce Azure: Nop Commerce Azure: Nop Commerce Full Sources with additionnals Azure Projects.Nwinsock: NWinsock: Nwinsock version 1.0 is hereOpen NFe: DANFe v1.9.8: Correção CSTOpenGL ES 2.0 Compact Framework Wrapper: v0.1 Sources: First rough release. It has a working sample application which renders a triangle with rotation. Don't expect anything great. Just a very early ...patterns & practices - Windows Azure Guidance: Code Drop 3: Second iteration of a-Expense on Azure. This release builds on the previous one and mainly focuses on replacing SQL Azure by Table Storage. We hav...Posh4DNN: Posh4DNN Scripts 2.0: This release greatly increases the speed of installation and incorporates the use of IIS and SQL Server Snap-ins for managing those services. Inst...Process Enactment Tool Framework: PET 1.1: PET Core new intermediate model with arbitrary "clean" relations among objects and several updates of the object fields (see DependencyInterfacesA...Project Tru Tiên: Elements-test V1-fix (v1): Là Elements-test V1 đã được fix các vấn đề sau: - Fix lỗi hiển thị thú cưỡi Hổ Kỳ Lân - Fix hiển thị tab tiếng trung --> sang tiếng việt - Fix hiể...Sentinel - Log Viewer: Sentinel 0.8.1 (nLog support): Build of the 0.8.1 code (svn revision 36823) which included support for both nLog and log4net that has been in SVN for a while but didn't have a bi...sgMotion Animation Library: SgMotion v1.1 (For Sunburn 1.3.1): SgMotion v1.1 (For Sunburn 1.3.1) This release includes both a Windows & Xbox sample. The sample is set to default at Forward rendering, but can e...sTASKedit: sTASKedit 44538 (Developer Alpha): + nearly all fields are viewed in this release for task verification and identifying of unknownsTest Project (ignore): asdf asdf asdf asdf asdf asdf asdf sadf sdf asdf a: ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ;dlf jkasdf ;lkasjdf ...Test Project (ignore): cdscs: csdcacacTroav: Traov20100331 Source Pre-Alpah: This is some experiements with implementing custom modules with Microsoft's Orchard frame work. This is very preliminary, and subject to change.Weather Report WebControls: WebWeatherReport: 主要文件的源代码WhoIs XML API: Initial Release: Initial ReleaseYou are here (for Windows Mobile): CAB file and Source Code: You can find more Controls and samples for Windows Mobile developers at: http://www.beemobile4.netMost Popular ProjectshmrEngineRawrWBFS ManagerASP.NET Ajax LibraryMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitAJAX Control ToolkitWindows Presentation Foundation (WPF)ASP.NETLiveUpload to FacebookMost Active ProjectsRawrGraffiti CMSBase Class LibrariesjQuery Library for SharePoint Web ServicesBlogEngine.NETMicrosoft Biology FoundationN2 CMSLINQ to TwitterManaged Extensibility FrameworkFarseer Physics Engine

    Read the article

  • ASP.NET and HTML5 Local Storage

    - by Stephen Walther
    My favorite feature of HTML5, hands-down, is HTML5 local storage (aka DOM storage). By taking advantage of HTML5 local storage, you can dramatically improve the performance of your data-driven ASP.NET applications by caching data in the browser persistently. Think of HTML5 local storage like browser cookies, but much better. Like cookies, local storage is persistent. When you add something to browser local storage, it remains there when the user returns to the website (possibly days or months later). Importantly, unlike the cookie storage limitation of 4KB, you can store up to 10 megabytes in HTML5 local storage. Because HTML5 local storage works with the latest versions of all modern browsers (IE, Firefox, Chrome, Safari), you can start taking advantage of this HTML5 feature in your applications right now. Why use HTML5 Local Storage? I use HTML5 Local Storage in the JavaScript Reference application: http://Superexpert.com/JavaScriptReference The JavaScript Reference application is an HTML5 app that provides an interactive reference for all of the syntax elements of JavaScript (You can read more about the application and download the source code for the application here). When you open the application for the first time, all of the entries are transferred from the server to the browser (all 300+ entries). All of the entries are stored in local storage. When you open the application in the future, only changes are transferred from the server to the browser. The benefit of this approach is that the application performs extremely fast. When you click the details link to view details on a particular entry, the entry details appear instantly because all of the entries are stored on the client machine. When you perform key-up searches, by typing in the filter textbox, matching entries are displayed very quickly because the entries are being filtered on the local machine. This approach can have a dramatic effect on the performance of any interactive data-driven web application. Interacting with data on the client is almost always faster than interacting with the same data on the server. Retrieving Data from the Server In the JavaScript Reference application, I use Microsoft WCF Data Services to expose data to the browser. WCF Data Services generates a REST interface for your data automatically. Here are the steps: Create your database tables in Microsoft SQL Server. For example, I created a database named ReferenceDB and a database table named Entities. Use the Entity Framework to generate your data model. For example, I used the Entity Framework to generate a class named ReferenceDBEntities and a class named Entities. Expose your data through WCF Data Services. I added a WCF Data Service to my project and modified the data service class to look like this:   using System.Data.Services; using System.Data.Services.Common; using System.Web; using JavaScriptReference.Models; namespace JavaScriptReference.Services { [System.ServiceModel.ServiceBehavior(IncludeExceptionDetailInFaults = true)] public class EntryService : DataService<ReferenceDBEntities> { // This method is called only once to initialize service-wide policies. public static void InitializeService(DataServiceConfiguration config) { config.UseVerboseErrors = true; config.SetEntitySetAccessRule("*", EntitySetRights.All); config.DataServiceBehavior.MaxProtocolVersion = DataServiceProtocolVersion.V2; } // Define a change interceptor for the Products entity set. [ChangeInterceptor("Entries")] public void OnChangeEntries(Entry entry, UpdateOperations operations) { if (!HttpContext.Current.Request.IsAuthenticated) { throw new DataServiceException("Cannot update reference unless authenticated."); } } } }     The WCF data service is named EntryService. Notice that it derives from DataService<ReferenceEntitites>. Because it derives from DataService<ReferenceEntities>, the data service exposes the contents of the ReferenceEntitiesDB database. In the code above, I defined a ChangeInterceptor to prevent un-authenticated users from making changes to the database. Anyone can retrieve data through the service, but only authenticated users are allowed to make changes. After you expose data through a WCF Data Service, you can use jQuery to retrieve the data by performing an Ajax call. For example, I am using an Ajax call that looks something like this to retrieve the JavaScript entries from the EntryService.svc data service: $.ajax({ dataType: "json", url: “/Services/EntryService.svc/Entries”, success: function (result) { var data = callback(result["d"]); } });     Notice that you must unwrap the data using result[“d”]. After you unwrap the data, you have a JavaScript array of the entries. I’m transferring all 300+ entries from the server to the client when the application is opened for the first time. In other words, I transfer the entire database from the server to the client, once and only once, when the application is opened for the first time. The data is transferred using JSON. Here is a fragment: { "d" : [ { "__metadata": { "uri": "http://superexpert.com/javascriptreference/Services/EntryService.svc/Entries(1)", "type": "ReferenceDBModel.Entry" }, "Id": 1, "Name": "Global", "Browsers": "ff3_6,ie8,ie9,c8,sf5,es3,es5", "Syntax": "object", "ShortDescription": "Contains global variables and functions", "FullDescription": "<p>\nThe Global object is determined by the host environment. In web browsers, the Global object is the same as the windows object.\n</p>\n<p>\nYou can use the keyword <code>this</code> to refer to the Global object when in the global context (outside of any function).\n</p>\n<p>\nThe Global object holds all global variables and functions. For example, the following code demonstrates that the global <code>movieTitle</code> variable refers to the same thing as <code>window.movieTitle</code> and <code>this.movieTitle</code>.\n</p>\n<pre>\nvar movieTitle = \"Star Wars\";\nconsole.log(movieTitle === this.movieTitle); // true\nconsole.log(movieTitle === window.movieTitle); // true\n</pre>\n", "LastUpdated": "634298578273756641", "IsDeleted": false, "OwnerId": null }, { "__metadata": { "uri": "http://superexpert.com/javascriptreference/Services/EntryService.svc/Entries(2)", "type": "ReferenceDBModel.Entry" }, "Id": 2, "Name": "eval(string)", "Browsers": "ff3_6,ie8,ie9,c8,sf5,es3,es5", "Syntax": "function", "ShortDescription": "Evaluates and executes JavaScript code dynamically", "FullDescription": "<p>\nThe following code evaluates and executes the string \"3+5\" at runtime.\n</p>\n<pre>\nvar result = eval(\"3+5\");\nconsole.log(result); // returns 8\n</pre>\n<p>\nYou can rewrite the code above like this:\n</p>\n<pre>\nvar result;\neval(\"result = 3+5\");\nconsole.log(result);\n</pre>", "LastUpdated": "634298580913817644", "IsDeleted": false, "OwnerId": 1 } … ]} I worried about the amount of time that it would take to transfer the records. According to Google Chome, it takes about 5 seconds to retrieve all 300+ records on a broadband connection over the Internet. 5 seconds is a small price to pay to avoid performing any server fetches of the data in the future. And here are the estimated times using different types of connections using Fiddler: Notice that using a modem, it takes 33 seconds to download the database. 33 seconds is a significant chunk of time. So, I would not use the approach of transferring the entire database up front if you expect a significant portion of your website audience to connect to your website with a modem. Adding Data to HTML5 Local Storage After the JavaScript entries are retrieved from the server, the entries are stored in HTML5 local storage. Here’s the reference documentation for HTML5 storage for Internet Explorer: http://msdn.microsoft.com/en-us/library/cc197062(VS.85).aspx You access local storage by accessing the windows.localStorage object in JavaScript. This object contains key/value pairs. For example, you can use the following JavaScript code to add a new item to local storage: <script type="text/javascript"> window.localStorage.setItem("message", "Hello World!"); </script>   You can use the Google Chrome Storage tab in the Developer Tools (hit CTRL-SHIFT I in Chrome) to view items added to local storage: After you add an item to local storage, you can read it at any time in the future by using the window.localStorage.getItem() method: <script type="text/javascript"> window.localStorage.setItem("message", "Hello World!"); </script>   You only can add strings to local storage and not JavaScript objects such as arrays. Therefore, before adding a JavaScript object to local storage, you need to convert it into a JSON string. In the JavaScript Reference application, I use a wrapper around local storage that looks something like this: function Storage() { this.get = function (name) { return JSON.parse(window.localStorage.getItem(name)); }; this.set = function (name, value) { window.localStorage.setItem(name, JSON.stringify(value)); }; this.clear = function () { window.localStorage.clear(); }; }   If you use the wrapper above, then you can add arbitrary JavaScript objects to local storage like this: var store = new Storage(); // Add array to storage var products = [ {name:"Fish", price:2.33}, {name:"Bacon", price:1.33} ]; store.set("products", products); // Retrieve items from storage var products = store.get("products");   Modern browsers support the JSON object natively. If you need the script above to work with older browsers then you should download the JSON2.js library from: https://github.com/douglascrockford/JSON-js The JSON2 library will use the native JSON object if a browser already supports JSON. Merging Server Changes with Browser Local Storage When you first open the JavaScript Reference application, the entire database of JavaScript entries is transferred from the server to the browser. Two items are added to local storage: entries and entriesLastUpdated. The first item contains the entire entries database (a big JSON string of entries). The second item, a timestamp, represents the version of the entries. Whenever you open the JavaScript Reference in the future, the entriesLastUpdated timestamp is passed to the server. Only records that have been deleted, updated, or added since entriesLastUpdated are transferred to the browser. The OData query to get the latest updates looks like this: http://superexpert.com/javascriptreference/Services/EntryService.svc/Entries?$filter=(LastUpdated%20gt%20634301199890494792L) If you remove URL encoding, the query looks like this: http://superexpert.com/javascriptreference/Services/EntryService.svc/Entries?$filter=(LastUpdated gt 634301199890494792L) This query returns only those entries where the value of LastUpdated > 634301199890494792 (the version timestamp). The changes – new JavaScript entries, deleted entries, and updated entries – are merged with the existing entries in local storage. The JavaScript code for performing the merge is contained in the EntriesHelper.js file. The merge() method looks like this:   merge: function (oldEntries, newEntries) { // concat (this performs the add) oldEntries = oldEntries || []; var mergedEntries = oldEntries.concat(newEntries); // sort this.sortByIdThenLastUpdated(mergedEntries); // prune duplicates (this performs the update) mergedEntries = this.pruneDuplicates(mergedEntries); // delete mergedEntries = this.removeIsDeleted(mergedEntries); // Sort this.sortByName(mergedEntries); return mergedEntries; },   The contents of local storage are then updated with the merged entries. I spent several hours writing the merge() method (much longer than I expected). I found two resources to be extremely useful. First, I wrote extensive unit tests for the merge() method. I wrote the unit tests using server-side JavaScript. I describe this approach to writing unit tests in this blog entry. The unit tests are included in the JavaScript Reference source code. Second, I found the following blog entry to be super useful (thanks Nick!): http://nicksnettravels.builttoroam.com/post/2010/08/03/OData-Synchronization-with-WCF-Data-Services.aspx One big challenge that I encountered involved timestamps. I originally tried to store an actual UTC time as the value of the entriesLastUpdated item. I quickly discovered that trying to work with dates in JSON turned out to be a big can of worms that I did not want to open. Next, I tried to use a SQL timestamp column. However, I learned that OData cannot handle the timestamp data type when doing a filter query. Therefore, I ended up using a bigint column in SQL and manually creating the value when a record is updated. I overrode the SaveChanges() method to look something like this: public override int SaveChanges(SaveOptions options) { var changes = this.ObjectStateManager.GetObjectStateEntries( EntityState.Modified | EntityState.Added | EntityState.Deleted); foreach (var change in changes) { var entity = change.Entity as IEntityTracking; if (entity != null) { entity.LastUpdated = DateTime.Now.Ticks; } } return base.SaveChanges(options); }   Notice that I assign Date.Now.Ticks to the entity.LastUpdated property whenever an entry is modified, added, or deleted. Summary After building the JavaScript Reference application, I am convinced that HTML5 local storage can have a dramatic impact on the performance of any data-driven web application. If you are building a web application that involves extensive interaction with data then I recommend that you take advantage of this new feature included in the HTML5 standard.

    Read the article

  • CodePlex Daily Summary for Saturday, April 24, 2010

    CodePlex Daily Summary for Saturday, April 24, 2010New ProjectsAutoWorkLoad: Is an application intended to load hours to accounting system such as TimeTracker automatically.Chemistry Add-in for Word: The Chemistry Add-in for Word makes it easier for students, chemists, and researchers to insert and modify chemical information, such as labels, fo...Exceptional Visualizer: A Debugger Visualizer for VS 2008 that allows for effective visual tracing of an Exception stack. Useful for Unity Resolution Exceptions as seen i...FTE Owner Requirement: FIM 2010 Activity: Forefront Identity Manager 2010 (FIM) activity designed to ensure that group object has at least one assigned Full Time Employee owner. This policy...Globus CB: Group project 2009-2010Highlighterr for Visual C++ 2010: A simple code syntax highlighter to change the colors of classes, structs, interfaces, macros and typedefs in the Visual C++ 2010 IDE. It is implem...HTML to word (.doc): easy to export your HTML code to Microsoft Word (.doc extension)IETT Hat Güzergah Importer: http://www.iett.gov.tr sitesinden otobüs hat ve güzergahlarını indirerek RegEx ile parse eder. Elde ettiği verileri SQL Server'a kaydeder.Industrial Dashboard: WCF service that allows executing SQL Server stored procedures straight from javascript code, enabling sending and receiving structured data withou...iSafePDF: iSafePDF is a PDF protection software. it allows you to encrypt PDF document, signe them using a certificate and timestamp the signature. all those...Kordinat Dönüştürücü: * UTM Koordinatlardan DDD koordinatlara iki yönlü dönüşüm. * Google Earth üzerinde koordinat, polygon ve ruhsat gösterimi. * Türkiye Paftalarının...LinkedIn® for Windows Mobile: LinkedIn® for Windows Mobile brings your LinkedIn® account to your Window Mobile powered phone. See networkupdates / connections / profile etc. Macrosome: An F# project demonstrates recording and replaying user operations.Markov Text Generator: Markov Text Generator.MEFedMVVM: Library for building MEF MVVM applications for Silverlight and WPF. By using this library you can easily build MVVM application. *UNDER Constructi...Mercurial to Team Foundation Server Work Item Hook: This is a Mercurial hook that will mark Team Foundation Server work items as resolved with a specific format in the commit description.Metaball WPF HLSL: Metaballs in WPF 3 with pixel shaders.Project Audiophile: Project Audiophile is a suite of applications and libraries built for .Net and Mono for the purposes of listening and organising music.RSS Application Updater: A Libbrary that helps you to update your app from your web site's feed. works very good with drupal .Sherwood Content Management Suite: A project that aims to provide a powerful and flexible tool for aggregating data from different data sources. Add your own plugins to store wanted ...Sonic.Net: Sonic.Net is a .Net Library designed to facilitate development of rich client applications both in Silverlight and WPF. Sonic.Net makes use of all ...StoichiometriCS: Stoichiometric Chemical Equation Solver.Vate Game Engine: Vate is a new XNA Game Engine. For more information about this project, please visit http://blog.aphysoft.com.Yahoo OpenID YQL Demo: This is demo program how to use Yahoo OpenID and Yahoo Query Language (YQL)New ReleasesBasic Sprite Sheet Creator: Sprite Tool V1.11: I had a small error when using multiple animations without the one pixel border that I overlooked when rewriting the code. It should be completely ...Braintree Client Library: Braintree-2.0.0: Updated IsSuccess() on transaction results to return false on declined transactions Search results now implement IEnumerable and will automatical...BV Commerce 5 Import Export Tools: Version 5.7.0 (for BV Commerce 5.7): Updated version compatible with BV Commerce 5.7. Do not use on earlier versions.Chemistry Add-in for Word: Chemistry Add-in for Word Beta 2: This is the source code release of the Chemistry Add-in for Word Beta 2. System Requirements To run this software, you’ll need the following: Wind...Controlled Vocabulary: 1.0.0.5: System Requirements Outlook 2007 / 2010 .Net Framework 3.5 VSTO 2010 Runtime Installation 1. Close Outlook (Use Task Manager to ensure no running ...DotNetNuke® Store: 02.01.33 RC: What's New in this release? Bugs corrected: - Fixed a bug related to encryption cookie. New Features: - Adden token pair [IFLOGGED] [/IFLOGGED] us...EdiliOS: Beta 0.2.1: Aggiunto supporto a FidoCadJ, editor FidoCad multipiattaforma di Davide Bucci, con Libreria di Ingegneria Civile integrata.Event Scavenger: Admin tool Version 3.1.1: Fixed the Admin tool that fails on editing general settings. Only Admin tool is affected.Exceptional Visualizer: Exception Visualizer: A Debugger Visualizer to help with long chains of exceptions where digging through the inner exceptions is hard to do. Specifically, this release ...fracback: Binaries: Use at your own riskFree Silverlight & WPF Chart Control - Visifire: Visifire for SL 4 and WPF Charts 3.5.1 Released: Hi, This release contains fix for the following bug: Chart threw exception with DateTime axis if IntervalType property was set as ‘Minutes’ in Ax...Free Silverlight & WPF Chart Control - Visifire: Visifire Silverlight and WPF Charts 3.0.8 Released: Hi, This release contains fix for the following bug: * Chart threw exception with DateTime axis if IntervalType property was set as ‘Minutes’...GeoUtility Library: GeoUtility Library 3.1.5.0: Please Note: This is an open source version. The commercial version offers much more functionality. Help files (english/german) are only available ...Highlighterr for Visual C++ 2010: Highlighterr for Visual C++ 2010 Test Release 1.0: To install the extension, download the and then double-click on the Highlighterr.vsix file. This should bring up a dialog saying something about wh...Highlighterr for Visual C++ 2010: Highlighterr for Visual C++ 2010 Test Release 1.01: The lack of support for /* */ comments was annoying me, so I added it. To install the extension, download the and then double-click on the Highlig...Home Access Plus+: v4.0.1.0: v4.0.1.0 Beta Change Log: Fixed an issue with laptops and the booking system (CSS and code fixes) Moved filters to top Added some Javascript to...HTML to word (.doc): FullSourceDownload: the full source contain: bin/AppWebdx7wusqu.dll Default.aspx htw.ascx htw.ascx.vb Web.configIndustrial Dashboard: 3.0 Beta: Added Example with Dojox.DataGrid Added Example with Ext.js ChartiSafePDF: iSafePDF v1.2: This is the first public release, this version support : PDF signature, timestamped signature, multi-signature, PDF encryption and meta-data modifi...linq.js - LINQ for JavaScript: ver 2.0.0.0: all code rewrite from scratch. enumerator support Dispose. namespace changed E, Linq.Enumerable -> Enumerable delete methods ToJSON ToTable Trace...LogikBug's IoC Container: Third Release: This project is dependent upon Microsoft.Practices.ServiceLocation and must be referenced when referencing LogikBug.Injection. Click here to view d...Macrosome: 0.0.1 preview: Key pointsOnly mouse clicks supported Just for preview: not stable How to useStart from Macrosome.Wpf.exe Click "Record" button will start oper...Mercurial to Team Foundation Server Work Item Hook: Version 0.1: This is the first version of the Mercurial to Team Foundation Server hook. It currently supports only adding comments to existing work items.MOSSDAL: MOSS Data Access Layer for data from the Sharepoint Lists Service: MOSSDAL Silverlight Framework Release 1: This is the first release of MOSSDAL for silverlight. For the MOSSDAL Framework for .NET release 1 click hereMOSSDAL: MOSS Data Access Layer for data from the Sharepoint Lists Service: MOSSDAL Silverlight Sample Release 1: This is the first release of the MOSSDAL framework samples for Silverlight. For the MOSSDAL .NET Release 1 Sample click hereMyWSAT - ASP.NET Membership Administration Tool: MyWSAT v3.5.1: MyWSAT 3.5.1 Update Notes - April 23rd 2010 1.) Fixed standard profile problem in web.config as well as on all the forms the profiles are used. The...NetPE: NetPE v1.0: Initial Release of NetPE. Features: -View & Editing Portable Executable -Hex editor -Full Metadata Support -Disassemble Cil/x86 codeNSIS Autorun: NSIS Autorun 0.1.1: NSIS Autorun 0.1.1 This release includes source code, application binary, and example materials.Over Store: OverStore Release 1.17.0.0: Version 1.17.0.0 - AdoNetStorage: AdoNetStorage refactored. Detailed Log messages added on each event. Database resource management moved to A...RoTwee: RoTwee (11.0.0.3): Fix for "17385 Remove saved degree val from code"Silverlight 4.0 Popup Menu: Popup Menu for Silverlight 4.0: This is the first project release. Added drop shadow and fade in effects. Left click and hover events are also supported.Silverlight 4.0 Popup Menu: Popup menu for Silverlight 4.0 Version 0.8: - Placed the invoker for the 'Opening' event handler within a dispatcher. This ensures that the visual tree is created before it is accessed.sNPCedit: sNPCedit v0.9: + Some changes in GUI and Behaviour + Added: Search functionSonic.Net: Sonic.Net v1.0.0: Sonic.Net v1.0.0 Targets Net 3.5 sp1 and Sinverlight 3 Includes: sonic.UnityConfiguration.Silverlight sonic.UnityConfiguration.WpfSurvey - web survey & form engine: Survey™ 1.2.1: Survey™ 1.2.1 release (based on the original Nsurvey 1.9.1. source files) New Features & fixes: 1. Final bits of code rewritten to become 100% ...SysPad: 4.10.10.2: Release Notes A folder management and scratchpad utility; especially useful in a business network setting that utilizes numerous, commonly used fol...Third Hand - Use your voice to control Visual Studio: Update for VS2010: Added support for VS2010, and minor improvements when using the grid.TiledLib: TiledLib 1.2: - Added overload of Map.Draw that specifies the area to draw - Added demo of a camera control for a mapXMLPreprocess: 2.0.12: What's new in this release: This release contains a number of enhancements based on feedback given through the discussion forums and issue tracker....Xrns2XMod: Xrns2Xmod 0.8: Added >> Real preliminary sound conversion for XM >> Some code optimizations Note Some samples might not be converted due to a flac parsing error ...Yahoo OpenID YQL Demo: Yahoo YQL .Net Demo: This is a demo program for using YQL with C#.netYahoo OpenID YQL Demo: YQL Demo: This is a demo program using Yahoo YQL with C#.NetYahoo OpenID YQL Demo: YQLDemo using .Net: This is a demo program for using Yahoo YQL with C#.NetMost Popular ProjectsRawrWBFS ManagerAJAX Control ToolkitSilverlight ToolkitMicrosoft SQL Server Product Samples: Databasepatterns & practices – Enterprise LibraryWindows Presentation Foundation (WPF)ASP.NETMicrosoft SQL Server Community & SamplesPHPExcelMost Active Projectspatterns & practices – Enterprise LibraryRawrBlogEngine.NETParticle Plot PivotNB_Store - Free DotNetNuke Ecommerce Catalog ModuleDotNetZip LibraryGMap.NET - Great Maps for Windows Forms & Presentationturing machine simulatorIonics Isapi Rewrite Filterpatterns & practices: Composite WPF and Silverlight

    Read the article

  • Upload Certificate and Key to RUEI in order to decrypt SSL traffic

    - by stefan.thieme(at)oracle.com
    So you want to monitor encrypted traffic with your RUEI collector ?Actually this is an easy thing if you follow the lines below...I will start out with creating a pair of snakeoil (so called self-signed) certificate and key with the make-ssl-cert tool which comes pre-packaged with apache only for the purpose of this example.$ sudo make-ssl-cert generate-default-snakeoil$ sudo ls -l /etc/ssl/certs/ssl-cert-snakeoil.pem /etc/ssl/private/ssl-cert-snakeoil.key-rw-r--r-- 1 root root     615 2010-06-07 10:03 /etc/ssl/certs/ssl-cert-snakeoil.pem-rw-r----- 1 root ssl-cert 891 2010-06-07 10:03 /etc/ssl/private/ssl-cert-snakeoil.keyRUEI Configuration of Security SSL Keys You will most likely get these two files from your Certificate Authority (CA) and/or your system administrators should be able to extract this from your WebServer or LoadBalancer handling SSL encryption for your infrastructure.Now let's look at the content of these two files, the certificate (apache assumes this is in PEM format) is called a public key and the private key is used by the apache server to encrypt traffic for a client using the certificate to initiate the SSL connection with the server.In case you already know that these two match, you simply have to paste them in one text file and upload this text file to your RUEI instance.$ sudo cat /etc/ssl/certs/ssl-cert-snakeoil.pem /etc/ssl/private/ssl-cert-snakeoil.key > /tmp/ruei.cert_and_key$ sudo cat /tmp/ruei.cert_and_key -----BEGIN CERTIFICATE----- MIIBmTCCAQICCQD7O3XXwVilWzANBgkqhkiG9w0BAQUFADARMQ8wDQYDVQQDEwZ1 YnVudHUwHhcNMTAwNjA3MDgwMzUzWhcNMjAwNjA0MDgwMzUzWjARMQ8wDQYDVQQD EwZ1YnVudHUwgZ8wDQYJKoZIhvcNAQEBBQADgY0AMIGJAoGBALbs+JnI+p+K7Iqa SQZdnYBxOpdRH0/9jt1QKvmH68v81h9+f1Z2rVR7Zrd/l+ruE3H9VvuzxMlKuMH7 qBX/gmjDZTlj9WJM+zc0tSk+e2udy9he20lGzTxv0vaykJkuKcvSWNk4WE9NuAdg IHZvjKgoTSVmvM1ApMCg69nyOy97AgMBAAEwDQYJKoZIhvcNAQEFBQADgYEAk2rv VEkxR1qPSpJiudDuGUHtWKBKWiWbmSwI3REZT+0vG+YDG5a55NdxgRk3zhQntqF7 gNYjKxblBByBpY7W0ci00kf7kFgvXWMeU96NSQJdnid/YxzQYn0dGL2rSh1dwdPN NPQlNSfnEQ1yxFevR7aRdCqTbTXU3mxi8YaSscE= -----END CERTIFICATE----- -----BEGIN RSA PRIVATE KEY----- MIICXgIBAAKBgQC27PiZyPqfiuyKmkkGXZ2AcTqXUR9P/Y7dUCr5h+vL/NYffn9W dq1Ue2a3f5fq7hNx/Vb7s8TJSrjB+6gV/4Jow2U5Y/ViTPs3NLUpPntrncvYXttJ Rs08b9L2spCZLinL0ljZOFhPTbgHYCB2b4yoKE0lZrzNQKTAoOvZ8jsvewIDAQAB AoGBAJ7LCWeeUwnKNFqBYmD3RTFpmX4furnal3lBDX0945BZtJr0WZ/6N679zIYA aiVTdGfgjvDC9lHy3n3uctRd0Jqdh2QoSSxNBhq5elIApNIIYzu7w/XI/VhGcDlA b6uadURQEC2q+M8YYjw3mwR2omhCWlHIViOHe/9T8jfP/8pxAkEA7k39WRcQildH DFKcj7gurqlkElHysacMTFWf0ZDTEUS6bdkmNXwK6mH63BlmGLrYAP5AMgKgeDf8 D+WRfv8YKQJBAMSCQ7UGDN3ysyfIIrdc1RBEAk4BOrKHKtD5Ux0z5lcQkaCYrK8J DuSldreN2yOhS99/S4CRWmGkTj04wRSnjwMCQQCaR5mW3QzTU4/m1XEQxsBKSdZE 2hMSmsCmhuSyK13Kl0FPLr/C7qyuc4KSjksABa8kbXaoKfUz/6LLs+ePXZ2JAkAv +mIPk5+WnQgS4XFgdYDrzL8HTpOHPSs+BHG/goltnnT/0ebvgXWqa5+1pyPm6h29 PrYveM2pY1Va6z1xDowDAkEAttfzAwAHz+FUhWQCmOBpvBuW/KhYWKZTMpvxFMSY YD5PH6NNyLfBx0J4nGPN5n/f6il0s9pzt3ko++/eUtWSnQ== -----END RSA PRIVATE KEY----- Simply click on the add new key and browse for the cert_and_key file on your desktop which you concatenated earlier using any text editor. You may need to add a passphrase in order to decrypt the RSA key in some cases (it should tell you BEGIN ENCRYPTED PRIVATE KEY in the header line). I will show you the success screen after uploading the certificate to RUEI. You may want to restart your collector once you have uploaded all the certificate/key pairs you want to use in order to make sure they get picked up asap.You should be able to see the number of SSL Connections rising in the Collector statistics screen below. The figures for decrypt errors should slowly go down and the usage figures for your encryption algortihm on the subsequent SSL Encryption screen should go up. You should be 100% sure everything works fine by now, otherwise see below to distinguish the remaining 1% from your 99% certainty.Verify Certificate and Key are matchingYou can compare the modulus of private key and public certificate and they should match in order for the key to fit the lock. You only want to make sure they both fit each other.We are actually interested only in the following details of the two files, which can be determined by using the -subject, -dates and -modulus command line switches instead of the complete -text output of the x509 certificate/rsa key contents.$ sudo openssl x509 -noout -subject -in /etc/ssl/certs/ssl-cert-snakeoil.pemsubject= /CN=ubuntu$ sudo openssl x509 -noout -dates -in /etc/ssl/certs/ssl-cert-snakeoil.pemnotBefore=Jun  7 08:03:53 2010 GMTnotAfter=Jun  4 08:03:53 2020 GMT$ sudo openssl x509 -noout -modulus -in /etc/ssl/certs/ssl-cert-snakeoil.pem Modulus=B6ECF899C8FA9F8AEC8A9A49065D9D80713A97511F4FFD8EDD502AF987EBCBFCD61F7E7F5676AD547B66B77F97EAEE1371FD56FBB3C4C94AB8C1FBA815FF8268C3653963F5624CFB3734B5293E7B6B9DCBD85EDB4946CD3C6FD2F6B290992E29CBD258D938584F4DB8076020766F8CA8284D2566BCCD40A4C0A0EBD9F23B2F7B $ sudo openssl rsa -noout -modulus -in /etc/ssl/private/ssl-cert-snakeoil.keyModulus=B6ECF899C8FA9F8AEC8A9A49065D9D80713A97511F4FFD8EDD502AF987EBCBFCD61F7E7F5676AD547B66B77F97EAEE1371FD56FBB3C4C94AB8C1FBA815FF8268C3653963F5624CFB3734B5293E7B6B9DCBD85EDB4946CD3C6FD2F6B290992E29CBD258D938584F4DB8076020766F8CA8284D2566BCCD40A4C0A0EBD9F23B2F7BAs you can see the modulus matches exactly and we have the proof that the certificate has been created using the private key. OpenSSL Certificate and Key DetailsAs I already told you, you do not need all the greedy details, but in case you want to know it in depth what is actually in those hex-blocks can be made visible with the following commands which show you the actual content in a human readable format.Note: You may not want to post all the details of your private key =^) I told you I have been using a self-signed certificate only for showing you these details.$ sudo openssl rsa -noout -text -in /etc/ssl/private/ssl-cert-snakeoil.keyPrivate-Key: (1024 bit)modulus:    00:b6:ec:f8:99:c8:fa:9f:8a:ec:8a:9a:49:06:5d:    9d:80:71:3a:97:51:1f:4f:fd:8e:dd:50:2a:f9:87:    eb:cb:fc:d6:1f:7e:7f:56:76:ad:54:7b:66:b7:7f:    97:ea:ee:13:71:fd:56:fb:b3:c4:c9:4a:b8:c1:fb:    a8:15:ff:82:68:c3:65:39:63:f5:62:4c:fb:37:34:    b5:29:3e:7b:6b:9d:cb:d8:5e:db:49:46:cd:3c:6f:    d2:f6:b2:90:99:2e:29:cb:d2:58:d9:38:58:4f:4d:    b8:07:60:20:76:6f:8c:a8:28:4d:25:66:bc:cd:40:    a4:c0:a0:eb:d9:f2:3b:2f:7bpublicExponent: 65537 (0x10001)privateExponent:    00:9e:cb:09:67:9e:53:09:ca:34:5a:81:62:60:f7:    45:31:69:99:7e:1f:ba:b9:da:97:79:41:0d:7d:3d:    e3:90:59:b4:9a:f4:59:9f:fa:37:ae:fd:cc:86:00:    6a:25:53:74:67:e0:8e:f0:c2:f6:51:f2:de:7d:ee:    72:d4:5d:d0:9a:9d:87:64:28:49:2c:4d:06:1a:b9:    7a:52:00:a4:d2:08:63:3b:bb:c3:f5:c8:fd:58:46:    70:39:40:6f:ab:9a:75:44:50:10:2d:aa:f8:cf:18:    62:3c:37:9b:04:76:a2:68:42:5a:51:c8:56:23:87:    7b:ff:53:f2:37:cf:ff:ca:71prime1:    00:ee:4d:fd:59:17:10:8a:57:47:0c:52:9c:8f:b8:    2e:ae:a9:64:12:51:f2:b1:a7:0c:4c:55:9f:d1:90:    d3:11:44:ba:6d:d9:26:35:7c:0a:ea:61:fa:dc:19:    66:18:ba:d8:00:fe:40:32:02:a0:78:37:fc:0f:e5:    91:7e:ff:18:29prime2:    00:c4:82:43:b5:06:0c:dd:f2:b3:27:c8:22:b7:5c:    d5:10:44:02:4e:01:3a:b2:87:2a:d0:f9:53:1d:33:    e6:57:10:91:a0:98:ac:af:09:0e:e4:a5:76:b7:8d:    db:23:a1:4b:df:7f:4b:80:91:5a:61:a4:4e:3d:38:    c1:14:a7:8f:03exponent1:    00:9a:47:99:96:dd:0c:d3:53:8f:e6:d5:71:10:c6:    c0:4a:49:d6:44:da:13:12:9a:c0:a6:86:e4:b2:2b:    5d:ca:97:41:4f:2e:bf:c2:ee:ac:ae:73:82:92:8e:    4b:00:05:af:24:6d:76:a8:29:f5:33:ff:a2:cb:b3:    e7:8f:5d:9d:89exponent2:    2f:fa:62:0f:93:9f:96:9d:08:12:e1:71:60:75:80:    eb:cc:bf:07:4e:93:87:3d:2b:3e:04:71:bf:82:89:    6d:9e:74:ff:d1:e6:ef:81:75:aa:6b:9f:b5:a7:23:    e6:ea:1d:bd:3e:b6:2f:78:cd:a9:63:55:5a:eb:3d:    71:0e:8c:03coefficient:    00:b6:d7:f3:03:00:07:cf:e1:54:85:64:02:98:e0:    69:bc:1b:96:fc:a8:58:58:a6:53:32:9b:f1:14:c4:    98:60:3e:4f:1f:a3:4d:c8:b7:c1:c7:42:78:9c:63:    cd:e6:7f:df:ea:29:74:b3:da:73:b7:79:28:fb:ef:    de:52:d5:92:9d$ sudo openssl x509 -noout -text -in /etc/ssl/certs/ssl-cert-snakeoil.pemCertificate:    Data:        Version: 1 (0x0)        Serial Number:            fb:3b:75:d7:c1:58:a5:5b        Signature Algorithm: sha1WithRSAEncryption        Issuer: CN=ubuntu        Validity            Not Before: Jun  7 08:03:53 2010 GMT            Not After : Jun  4 08:03:53 2020 GMT        Subject: CN=ubuntu        Subject Public Key Info:            Public Key Algorithm: rsaEncryption            RSA Public Key: (1024 bit)                Modulus (1024 bit):                    00:b6:ec:f8:99:c8:fa:9f:8a:ec:8a:9a:49:06:5d:                    9d:80:71:3a:97:51:1f:4f:fd:8e:dd:50:2a:f9:87:                    eb:cb:fc:d6:1f:7e:7f:56:76:ad:54:7b:66:b7:7f:                    97:ea:ee:13:71:fd:56:fb:b3:c4:c9:4a:b8:c1:fb:                    a8:15:ff:82:68:c3:65:39:63:f5:62:4c:fb:37:34:                    b5:29:3e:7b:6b:9d:cb:d8:5e:db:49:46:cd:3c:6f:                    d2:f6:b2:90:99:2e:29:cb:d2:58:d9:38:58:4f:4d:                    b8:07:60:20:76:6f:8c:a8:28:4d:25:66:bc:cd:40:                    a4:c0:a0:eb:d9:f2:3b:2f:7b                Exponent: 65537 (0x10001)    Signature Algorithm: sha1WithRSAEncryption        93:6a:ef:54:49:31:47:5a:8f:4a:92:62:b9:d0:ee:19:41:ed:        58:a0:4a:5a:25:9b:99:2c:08:dd:11:19:4f:ed:2f:1b:e6:03:        1b:96:b9:e4:d7:71:81:19:37:ce:14:27:b6:a1:7b:80:d6:23:        2b:16:e5:04:1c:81:a5:8e:d6:d1:c8:b4:d2:47:fb:90:58:2f:        5d:63:1e:53:de:8d:49:02:5d:9e:27:7f:63:1c:d0:62:7d:1d:        18:bd:ab:4a:1d:5d:c1:d3:cd:34:f4:25:35:27:e7:11:0d:72:        c4:57:af:47:b6:91:74:2a:93:6d:35:d4:de:6c:62:f1:86:92:        b1:c1The above output can also be seen if you direct your browser client to your website and check the certificate sent by the server to your browser. You will be able to lookup all the details including the validity dates, subject common name and the public key modulus.Capture an SSL connection using WiresharkAnd as you would have expected, looking at the low-level tcp data that has been exchanged between the client and server with a tcp-diagnostics tool (i.e. wireshark/tcpdump) you can also see the modulus in there.These were the settings I used to capture all traffic on the local loopback interface, matching the filter expression: tcp and ip and host 127.0.0.1 and port 443. This tells Wireshark to leave out any other information, I may not have been interested in showing you.

    Read the article

  • CodePlex Daily Summary for Friday, February 11, 2011

    CodePlex Daily Summary for Friday, February 11, 2011Popular ReleasesSnoop, the WPF Spy Utility: Snoop 2.6.1: This release is a bug fixing release. Most importantly, issues have been seen around WPF 4.0 applications not always showing up in the app chooser. Hopefully, they are fixed now. I thought this issue warranted a minor release since more and more people are going WPF 4.0 and I don't want anyone to have any problems. Dan Hanan also contributes again with several usability features. Thanks Dan! Happy Snooping! p.s. By request, I am also attaching a .zip file ... so that people can install it ...RIBA - Rich Internet Business Application for Silverlight: Preview of MVVM Framework Source + Tutorials: This is a first public release of the MVVM Framework which is part of the final RIBA application. The complete RIBA example LOB application has yet to be published. Further Documentation on the MVVM part can be found on the Blog, http://www.SilverlightBlog.Net and in the downloadable source ( mvvm/doc/ ). Please post all issues and suggestions in the issue tracker.SharePoint Learning Kit: 1.5: SharePoint Learning Kit 1.5 has the following new functionality: *Support for SharePoint 2010 *E-Learning Actions can be localised *Two New Document Library Edit Options *Automatically add the Assignment List Web Part to the Web Part Gallery *Various Bug Fixes for the Drop Box There are 2 downloads for this release SLK-1.5-2010.zip for SharePoint 2010 SLK-1.5-2007.zip for SharePoint 2007 (WSS3 & MOSS 2007)Facebook C# SDK: 5.0.3 (BETA): This is fourth BETA release of the version 5 branch of the Facebook C# SDK. Remember this is a BETA build. Some things may change or not work exactly as planned. We are absolutely looking for feedback on this release to help us improve the final 5.X.X release. For more information about this release see the following blog posts: Facebook C# SDK - Writing your first Facebook Application Facebook C# SDK v5 Beta Internals Facebook C# SDK V5.0.0 (BETA) Released We have spend time trying ...NodeXL: Network Overview, Discovery and Exploration for Excel: NodeXL Excel Template, version 1.0.1.161: The NodeXL Excel template displays a network graph using edge and vertex lists stored in an Excel 2007 or Excel 2010 workbook. What's NewThis release adds a new Twitter List network importer, makes some minor feature improvements, and fixes a few bugs. See the Complete NodeXL Release History for details. Installation StepsFollow these steps to install and use the template: Download the Zip file. Unzip it into any folder. Use WinZip or a similar program, or just right-click the Zip file...WatchersNET.TagCloud: WatchersNET.TagCloud 01.09.03: Whats NewAdded New Skin TagTastic http://www.watchersnet.de/Portals/0/screenshots/dnn/TagCloud-TagTastic-Skin.jpg Added New Skin RoundedButton http://www.watchersnet.de/Portals/0/screenshots/dnn/TagCloud-RoundedButton-Skin.jpg changes Tag Count fixed on Tag Source Referrals Fixed Tag Count when multiple Tag Sources are usedExtremeML: ExtremeML v1.0 Beta 3: VS solution source code updated for compatibility with VS2010 (accommodates VS2010 breaking changes in T4 template support).Finestra Virtual Desktops: 1.1: This release adds a few more performance and graphical enhancements to 1.0. Switching desktops is now about as fast as you can blink. Desktop switching optimizations New welcome wizard for Vista/7 Fixed a few minor bugs Added a few more options to the options dialog (including ability to disable the taskbar switching)WCF Data Services Toolkit: WCF Data Services Toolkit: The source code and binary releases of the WCF Data Services Toolkit. For simplicity, the source code download doesn't include any of the MSTest files. If you want those, you can pull the code down via MercurialyoutubeFisher: youtubeFisher 3.0 [beta]: What's new: Video capturing improved Supports YouTube's new layout (january 2011) Internal refactoringNearforums - ASP.NET MVC forum engine: Nearforums v5.0: Version 5.0 of the ASP.NET MVC Forum Engine, containing the following improvements: .NET 4.0 as target framework using ASP.NET MVC 3. All views migrated to Razor for cleaner markup. Alternate template (Layout file) for mobile devices 4 Bug Fixes since Version 4.1 Visit the project Roadmap for more details. Webdeploy package sha1 checksum: 28785b7248052465ea0738a7775e8e8744d84c27fuv: 1.0 release, codename Chopper Joe: features: search/replace :o to open file :s to save file :q to quitASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.7: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager html generation optimized new features for the lookup (add additional search data ) live demo went aeroEnhSim: EnhSim 2.3.6 BETA: 2.3.6 BETAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 Changes since 2.3.0 ...TestApi - a library of Test APIs: TestApi v0.6: TestApi v0.6 comes with the following changes: TestApi code development has been moved to Codeplex: Moved TestApi soluton to VS 2010; Moved all source code to Codeplex. All development work is done there now. Fault Injection API: Integrated the unmanaged FaultInjectionEngine.dll COM component in the build; Cleaned up FaultInjectionEngine.dll to build at warning level 4; Implemented “FaultScope” which allows for in-process fault injection; Added automation scripts & sample program; ...AutoLoL: AutoLoL v1.5.5: AutoChat now allows up to 6 items. Items with nr. 7-0 will be removed! News page url's are now opened in the default browser Added a context menu to the system tray icon (thanks to Alex Banagos) AutoChat now allows configuring the Chat Keys and the Modifier Key The recent files list now supports compact and full mode Fix: Swapped mouse buttons are now properly detected Fix: Sometimes the Play button was pressed while still greyed out Champion: Karma Note: You can also run the u...mojoPortal: 2.3.6.2: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2362-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Rawr: Rawr 4.0.19 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you have a problem, please follow the Posting Guidelines and put it into the Issue Trac...IronRuby: 1.1.2: IronRuby 1.1.2 is a servicing release that keeps on improving compatibility with Ruby 1.9.2 and includes IronRuby integration to Visual Studio 2010. We decided to drop 1.8.6 compatibility mode in all post-1.0 releases. We recommend using IronRuby 1.0 if you need 1.8.6 compatibility. In this release we fixed several major issues: - problems that blocked Gem installation in certain cases - regex syntax: the parser was replaced with a new one that is much more compatible with Ruby 1.9.2 - cras...MVVM Light Toolkit: MVVM Light Toolkit V3 SP1 (4): There was a small issue with the previous release that caused errors when installing the templates in VS10 Express. This release corrects the error. Only use this if you encountered issues when installing the previous release. No changes in the binaries.New ProjectsAlchemySearch: A middleware application that allows the searching of Open Text's Alchemy application from a command line or from a calling application. C# .NET 4alltuan: all tuan infoasp.net mvc 2.0 ??????: asp.net mvc 2.0 ??????Basic Text File Generator: This is an investigatory development that creates text files from a windows forms app.bisolu_luc: nothing yetCriteria Pack for EPiServer CMS: This is a collection of useful criteria for extending the personalization mechanism, Visitor Groups, in EPiServer CMS 6 R2 (or later).CTRNN.NET: CTRNN.NET is a C# implementation of Continuous Time Recurrent Neural Networks.DXperience Toolkit: Complimentary controls and libraries from DevExpress.Excel Library for Small Basic: This library extend Small Basic to allows you to read or write contents of a cell in the Excel file from Small Basic program. ???????? Small Basic ????、Small Basic ??? Excel ???????????????????。HealthVault Eventing Sample: A sample application demonstrating the new HealthVault Eventing feature.Hitcents Blog - Example Code: Contains various source code examples from articles at http://www.hitcents.com/blog. Brought to you by Hitcents.INI Modifier: A proprietary application to amend users ini files for JBAe automatically from a central control file.issueIT.net - ”I just found the last bug”: issueIT is the best open source web-based issue tracker for .NET. It’s easy to customize to suit your organization. This project is not finished yet - it is only at a very early stage Leage of Legends Masteries Tool: -Small, portable and fast tool to help you set your masteries. -No Install. -Masteries saved in the same folder: "lolMasterSet.dat" (text file) How to use: - Run and then go to masteries tab in League of Legends luncher. You should see the overlay. Memory View controls: Memory View controls are a pair of controls for real time and static viewing and editing of a memory space. MemoryHexEditor is a hex editor that supports viewing and editing memory, and MemoryHeatMap is a time-based graphical view that shows how memory is read and written to.Moq Contrib: Community contributions to Moq.Operating System Basic: Sistema operacional desenvolvido em QuickBasic, durante minha adolecência.PAiRS - A WPF Memory Card Game: PAiRS is an implementation of a card matching game in which you are given an even number of cards face down in a grid, and you try to flip over 2 cards at a time to create a match until all cards are matched. PAiRS is built using C#, .Net 3.5+ and WPF.RIBA - Rich Internet Business Application for Silverlight: RIBA is an example LOB application with many features to show how to build distributed and secure Line of Business applications based on Silverlight 4. You can find the official blog on www.silverlightblog.netSearcher: Searcher is a Windows Phone project which allows you to quickly search using multiple search engines. SharePoint Term Store Powershell Utilities: An assortment of PowerShell script-based utilities to perform actions on the SharePoint Managed Metadata Term Store. PowerShell script-based utilities have been chosen rather than cmdlets as they are more suitable for environments that have strict installation policies.SmartHotelFoundation: Smart Hotel FoundationSumer Filemanager: This project ensured fully ajax based file management.The Open Source PMU: The Open Source PMU Project provides resources that enable you to build your own SynchroPhasor sensor for use with the openPDC project, research, development, or electric grid observation.Trail Blazer: Movie Trailer Fetcher - Downloads trailers for movies in a collection and saves them in movie folder. It is being developed as a companion to Meta Data Fetchers for the Media Browser project. It is being developed as a standalone C# app but a frontend in MCML is being considered.University Project Tracker: University Project TrackerVideo Backup Fusion: The complete and simply to use backup solution for video portalsWPF ShellFactory: WPF ShellFactory is an easy-to-use application framework for WPF, using a system derived from M-V-VM for its views. It supports multiple modules, either statically or dynamically loaded (i.e. plugins). It also contains mechanisms for application-wide services.

    Read the article

  • Metro Walkthrough: Creating a Task List with a ListView and IndexedDB

    - by Stephen.Walther
    The goal of this blog entry is to describe how you can work with data in a Metro style application written with JavaScript. In particular, we create a super simple Task List application which enables you to create and delete tasks. Here’s a video which demonstrates how the Task List application works: In order to build this application, I had to take advantage of several features of the WinJS library and technologies including: IndexedDB – The Task List application stores data in an IndexedDB database. HTML5 Form Validation – The Task List application uses HTML5 validation to ensure that a required field has a value. ListView Control – The Task List application displays the tasks retrieved from the IndexedDB database in a WinJS ListView control. Creating the IndexedDB Database The Task List application stores all of its data in an IndexedDB database named TasksDB. This database is opened/created with the following code: var db; var req = window.msIndexedDB.open("TasksDB", 1); req.onerror = function () { console.log("Could not open database"); }; req.onupgradeneeded = function (evt) { var newDB = evt.target.result; newDB.createObjectStore("tasks", { keyPath: "id", autoIncrement:true }); }; The msIndexedDB.open() method accepts two parameters: the name of the database to open and the version of the database to open. If a database with a matching version already exists, then calling the msIndexedDB.open() method opens a connection to the existing database. If the database does not exist then the upgradeneeded event is raised. You handle the upgradeneeded event to create a new database. In the code above, the upgradeneeded event handler creates an object store named “tasks” (An object store roughly corresponds to a database table). When you add items to the tasks object store then each item gets an id property with an auto-incremented value automatically. The code above also includes an error event handler. If the IndexedDB database cannot be opened or created, for whatever reason, then an error message is written to the Visual Studio JavaScript Console window. Displaying a List of Tasks The TaskList application retrieves its list of tasks from the tasks object store, which we created above, and displays the list of tasks in a ListView control. Here is how the ListView control is declared: <div id="tasksListView" data-win-control="WinJS.UI.ListView" data-win-options="{ itemDataSource: TaskList.tasks.dataSource, itemTemplate: select('#taskTemplate'), tapBehavior: 'toggleSelect', selectionMode: 'multi', layout: { type: WinJS.UI.ListLayout } }"> </div> The ListView control is bound to the TaskList.tasks.dataSource data source. The TaskList.tasks.dataSource is created with the following code: // Create the data source var tasks = new WinJS.Binding.List(); // Open the database var db; var req = window.msIndexedDB.open("TasksDB", 1); req.onerror = function () { console.log("Could not open database"); }; req.onupgradeneeded = function (evt) { var newDB = evt.target.result; newDB.createObjectStore("tasks", { keyPath: "id", autoIncrement:true }); }; // Load the data source with data from the database req.onsuccess = function () { db = req.result; var tran = db.transaction("tasks"); tran.objectStore("tasks").openCursor().onsuccess = function(event) { var cursor = event.target.result; if (cursor) { tasks.dataSource.insertAtEnd(null, cursor.value); cursor.continue(); }; }; }; // Expose the data source and functions WinJS.Namespace.define("TaskList", { tasks: tasks }); Notice the success event handler. This handler is called when a database is successfully opened/created. In the code above, all of the items from the tasks object store are retrieved into a cursor and added to a WinJS.Binding.List object named tasks. Because the ListView control is bound to the WinJS.Binding.List object, copying the tasks from the object store into the WinJS.Binding.List object causes the tasks to appear in the ListView: Adding a New Task You add a new task in the Task List application by entering the title of a new task into an HTML form and clicking the Add button. Here’s the markup for creating the form: <form id="addTaskForm"> <input id="newTaskTitle" title="New Task" required /> <button>Add</button> </form> Notice that the INPUT element includes a required attribute. In a Metro application, you can take advantage of HTML5 Validation to validate form fields. If you don’t enter a value for the newTaskTitle field then the following validation error message is displayed: For a brief introduction to HTML5 validation, see my previous blog entry: http://stephenwalther.com/blog/archive/2012/03/13/html5-form-validation.aspx When you click the Add button, the form is submitted and the form submit event is raised. The following code is executed in the default.js file: // Handle Add Task document.getElementById("addTaskForm").addEventListener("submit", function (evt) { evt.preventDefault(); var newTaskTitle = document.getElementById("newTaskTitle"); TaskList.addTask({ title: newTaskTitle.value }); newTaskTitle.value = ""; }); The code above retrieves the title of the new task and calls the addTask() method in the tasks.js file. Here’s the code for the addTask() method which is responsible for actually adding the new task to the IndexedDB database: // Add a new task function addTask(taskToAdd) { var transaction = db.transaction("tasks", "readwrite"); var addRequest = transaction.objectStore("tasks").add(taskToAdd); addRequest.onsuccess = function (evt) { taskToAdd.id = evt.target.result; tasks.dataSource.insertAtEnd(null, taskToAdd); } } The code above does two things. First, it adds the new task to the tasks object store in the IndexedDB database. Second, it adds the new task to the data source bound to the ListView. The dataSource.insertAtEnd() method is called to add the new task to the data source so the new task will appear in the ListView (with a nice little animation). Deleting Existing Tasks The Task List application enables you to select one or more tasks by clicking or tapping on one or more tasks in the ListView. When you click the Delete button, the selected tasks are removed from both the IndexedDB database and the ListView. For example, in the following screenshot, two tasks are selected. The selected tasks appear with a teal background and a checkmark: When you click the Delete button, the following code in the default.js file is executed: // Handle Delete Tasks document.getElementById("btnDeleteTasks").addEventListener("click", function (evt) { tasksListView.winControl.selection.getItems().then(function(items) { items.forEach(function (item) { TaskList.deleteTask(item); }); }); }); The selected tasks are retrieved with the TaskList selection.getItem() method. In the code above, the deleteTask() method is called for each of the selected tasks. Here’s the code for the deleteTask() method: // Delete an existing task function deleteTask(listViewItem) { // Database key != ListView key var dbKey = listViewItem.data.id; var listViewKey = listViewItem.key; // Remove item from db and, if success, remove item from ListView var transaction = db.transaction("tasks", “readwrite”); var deleteRequest = transaction.objectStore("tasks").delete(dbKey); deleteRequest.onsuccess = function () { tasks.dataSource.remove(listViewKey); } } This code does two things: it deletes the existing task from the database and removes the existing task from the ListView. In both cases, the right task is removed by using the key associated with the task. However, the task key is different in the case of the database and in the case of the ListView. In the case of the database, the task key is the value of the task id property. In the case of the ListView, on the other hand, the task key is auto-generated by the ListView. When the task is removed from the ListView, an animation is used to collapse the tasks which appear above and below the task which was removed. The Complete Code Above, I did a lot of jumping around between different files in the application and I left out sections of code. For the sake of completeness, I want to include the entire code here: the default.html, default.js, and tasks.js files. Here are the contents of the default.html file. This file contains the UI for the Task List application: <!DOCTYPE html> <html> <head> <meta charset="utf-8"> <title>Task List</title> <!-- WinJS references --> <link href="//Microsoft.WinJS.0.6/css/ui-dark.css" rel="stylesheet"> <script src="//Microsoft.WinJS.0.6/js/base.js"></script> <script src="//Microsoft.WinJS.0.6/js/ui.js"></script> <!-- TaskList references --> <link href="/css/default.css" rel="stylesheet"> <script src="/js/default.js"></script> <script type="text/javascript" src="js/tasks.js"></script> <style type="text/css"> body { font-size: x-large; } form { display: inline; } #appContainer { margin: 20px; width: 600px; } .win-container { padding: 10px; } </style> </head> <body> <div> <!-- Templates --> <div id="taskTemplate" data-win-control="WinJS.Binding.Template"> <div> <span data-win-bind="innerText:title"></span> </div> </div> <h1>Super Task List</h1> <div id="appContainer"> <form id="addTaskForm"> <input id="newTaskTitle" title="New Task" required /> <button>Add</button> </form> <button id="btnDeleteTasks">Delete</button> <div id="tasksListView" data-win-control="WinJS.UI.ListView" data-win-options="{ itemDataSource: TaskList.tasks.dataSource, itemTemplate: select('#taskTemplate'), tapBehavior: 'toggleSelect', selectionMode: 'multi', layout: { type: WinJS.UI.ListLayout } }"> </div> </div> </div> </body> </html> Here is the code for the default.js file. This code wires up the Add Task form and Delete button: (function () { "use strict"; var app = WinJS.Application; app.onactivated = function (eventObject) { if (eventObject.detail.kind === Windows.ApplicationModel.Activation.ActivationKind.launch) { WinJS.UI.processAll().then(function () { // Get reference to Tasks ListView var tasksListView = document.getElementById("tasksListView"); // Handle Add Task document.getElementById("addTaskForm").addEventListener("submit", function (evt) { evt.preventDefault(); var newTaskTitle = document.getElementById("newTaskTitle"); TaskList.addTask({ title: newTaskTitle.value }); newTaskTitle.value = ""; }); // Handle Delete Tasks document.getElementById("btnDeleteTasks").addEventListener("click", function (evt) { tasksListView.winControl.selection.getItems().then(function(items) { items.forEach(function (item) { TaskList.deleteTask(item); }); }); }); }); } }; app.start(); })(); Finally, here is the tasks.js file. This file contains all of the code for opening, creating, and interacting with IndexedDB: (function () { "use strict"; // Create the data source var tasks = new WinJS.Binding.List(); // Open the database var db; var req = window.msIndexedDB.open("TasksDB", 1); req.onerror = function () { console.log("Could not open database"); }; req.onupgradeneeded = function (evt) { var newDB = evt.target.result; newDB.createObjectStore("tasks", { keyPath: "id", autoIncrement:true }); }; // Load the data source with data from the database req.onsuccess = function () { db = req.result; var tran = db.transaction("tasks"); tran.objectStore("tasks").openCursor().onsuccess = function(event) { var cursor = event.target.result; if (cursor) { tasks.dataSource.insertAtEnd(null, cursor.value); cursor.continue(); }; }; }; // Add a new task function addTask(taskToAdd) { var transaction = db.transaction("tasks", "readwrite"); var addRequest = transaction.objectStore("tasks").add(taskToAdd); addRequest.onsuccess = function (evt) { taskToAdd.id = evt.target.result; tasks.dataSource.insertAtEnd(null, taskToAdd); } } // Delete an existing task function deleteTask(listViewItem) { // Database key != ListView key var dbKey = listViewItem.data.id; var listViewKey = listViewItem.key; // Remove item from db and, if success, remove item from ListView var transaction = db.transaction("tasks", "readwrite"); var deleteRequest = transaction.objectStore("tasks").delete(dbKey); deleteRequest.onsuccess = function () { tasks.dataSource.remove(listViewKey); } } // Expose the data source and functions WinJS.Namespace.define("TaskList", { tasks: tasks, addTask: addTask, deleteTask: deleteTask }); })(); Summary I wrote this blog entry because I wanted to create a walkthrough of building a simple database-driven application. In particular, I wanted to demonstrate how you can use a ListView control with an IndexedDB database to store and retrieve database data.

    Read the article

< Previous Page | 230 231 232 233 234 235 236 237  | Next Page >