Search Results

Search found 16688 results on 668 pages for 'expression language'.

Page 236/668 | < Previous Page | 232 233 234 235 236 237 238 239 240 241 242 243  | Next Page >

  • What are the most important things to know about Ruby?

    - by Brian T Hannan
    I am new to the language and I need to know what are the top things that are absolutely necessary to know in order to make a fully functional website or web app using the Ruby programming language? Mainly Ruby on Rails with Rake and other tools that mainly use Rake. Update: I know many other languages like C++, Java, PHP, Perl, etc, etc .... Update 2: This is great ... keep 'em coming!

    Read the article

  • Why isn't LISP more widely used?

    - by Chris
    I've heard a lot of people espouse the capabilities of LISP and its omnipotent macros. If LISP is such a great language, why isn't it being adopted more? What problems is LISP facing that is holding it back from (re)emerging as popular language? Is it something about LISP itself ("those brackets!" isn't the answer, is it?!), or its competitors (e.g. the dominance of Java, .NET)?

    Read the article

  • What are good alternatives to SQL?

    - by Brendan Long
    I occasionally hear things about how SQL sucks and it's not a good language, but I never really hear much about alternatives to it. So, are other good languages that serve the same purpose (database access) and what makes them better than SQL? Are there any good databases that use this alternative language?

    Read the article

  • C++ code which is slower than its C equivalent?

    - by user997112
    Are there any aspects to the C++ programming language where the code is known to be slower than the equivalent C language? Obviously this would be excluding the OO features like virtual functions and vtable features etc. I am wondering whether, when you are programming in a latency-critical area (and you aren't worried about OO features) whether you could stick with basic C++ or would C be better?

    Read the article

  • Why is "int + string" possible in statically-typed C# but not in dynamically-typed Python?

    - by Salvador Dali
    While studying C# I found it really strange, that dynamically typed Python will rise an error in the following code: i = 5 print i + " " whereas statically typed C# will normally proceed the similar code: int i = 5; Console.Write(i + " "); I would expect other way around (in python I would be able to do this without any casting, but C# would require me to cast int to string or string to int). Just to highlight, I am not asking what language is better, I am curious what was the reason behind implementing the language this way.

    Read the article

  • Do really need a count lock on Multi threads with one CPU core?

    - by MrROY
    If i have some code looks like this(Please ignore the syntax, i want to understand it without a specified language): count = 0 def countDown(): count += 1 if __name__ == '__main__': thread1(countDown) thread2(countDown) thread3(countDown) Here i have a CPU with only one core, do i really need a lock to the variable count in case of it could be over-written by other threads. I don't know, but if the language cares a lot, please explain it under Java?C and Python, So many thanks.

    Read the article

  • Disable VB.NET 10 Features in VS 2010

    - by Keivan
    is there a way to disable visual basic 10 language features in VS 2010. our Dev team has moved to Visual studio 2010, but we still have to keep backwards compatibility with Visual Studio 2008. is there a way to disable the new language features to avoid any issues.

    Read the article

  • Internationalization string testing

    - by LicenseQ
    Some people using look-alike Unicode symbols to replace English characters to test the internationalization, e.g. "Test" is replaced as "Test". Is there a wellknown name for this language/culture? Are there utils, keyboard layouts, translation tools for this "language"?

    Read the article

  • How to get selected text from a webpage?

    - by user128647
    I need to retrieve only selected portion of a webpage (user open a webpage in web-browser control, then he/she would select some portion of a webpage, i just need only those selected portion/text) in vb.net in visual basic language. How to do ? i am using microsoft visual studio 2008 Language: Visual Basic FrameWork: vb.net 3.5

    Read the article

  • localize many images in Xcode at once?

    - by Sebastian
    I have this project that i need to add a translation to. I already know how to add localisation to single image files, but there are 200+ images with text on it in that project. Do i really have to click one file at a time, "get info", click "add localisation" enter the Language and click OK for every file? When i select multiple images the languages and do those steps the new language is not added :-/ Please someone have a way to save me from insanity ;-) Thanks! S

    Read the article

  • HTML5 -- server side

    - by Joe Cannatti
    How much does it matter what server side language is used for building a web app to take advantage of HTML 5? It seems to me that the ruby community will probably have the fastest uptake, and as a result the most support. Does that seem right? If I want to make a serious investment in HTML5, what server side language should I use?

    Read the article

  • What do I need to develop an Iron Python web app in Visual Studio 2010

    - by Greg
    Hi, I've got Visual Studio 2010. To develop a web app in Iron Python (i.e. to use a Ruby like language not C#) what downloads to I need? e.g. is the DLR already in VS2010, Iron Python itself Once setup would I actually be still developing an ASP.net MVC web app but just using Ruby for the language, or is the model something different to this? thanks

    Read the article

  • Convert HTML to RTF (HTML2RTF converter)

    - by Luca Matteis
    I'm looking for a simple HTML2RTF converter that I can use on my website which is using a *nix like Operating System. I haven't found anything on the internet, and was hoping the SO community would help me. PS: I don't want to implement this from scratch, and it doesn't really matter what language it's in, as long as I can run it on a *nix like system. If you guys have already some personalized implementation, the language preferred would be PHP.

    Read the article

  • Which is the best pick?

    - by Daniel
    Hi, considering I have experience with Java SE: which language should I learn(and is best for that purpose) in order to build web applications some day with it? I have been contemplating PHP and Java EE. The latter does indeed seems as an obvious choice given my Java SE knowledge. But how does it fares in comparison with PHP and how good is it for the aforementioned purpose? If there is a better language for this purpose, feel free to recommend it. Thank you.

    Read the article

  • Inspiration and influence of the else clause of loop statements in Python?

    - by Aristide
    Python offers an optional else clause in loop statements, which is executed if and only if the loop is not terminated by a break. For an interesting discussion about this neglected commodity, see this question. Here, I just wanted to know: if the very concept of this loop-else construct originates from another language (either theoretical or actually implemented), conversely, if it was taken up in any newer language. May be I should ask the former to Guido, but he surely is a too busy guy for such a futile inquiry. ;-)

    Read the article

  • Defined variables and arrays vs functions in php

    - by Frank Presencia Fandos
    Introduction I have some sort of values that I might want to access several times each page is loaded. I can take two different approaches for accessing them but I'm not sure which one is 'better'. Three already implemented examples are several options for the Language, URI and displaying text that I describe here: Language Right now it is configured in this way: lang() is a function that returns different values depending on the argument. Example: lang("full") returns the current language, "English", while lang() returns the abbreviation of the current language, "en". There are many more options, like lang("select"), lang("selectact"), etc that return different things. The code is too long and irrelevant for the case so if anyone wants it just ask for it. Url The $Url array also returns different values depending on the request. The whole array is fully defined in the beginning of the page and used to get shorter but accurate links of the current page. Example: $Url['full'] would return "http://mypage.org/path/to/file.php?page=1" and $Url['file'] would return "file.php". It's useful for action="" within the forms and many other things. There are more values for $Url['folder'], $Url['file'], etc. Same thing about the code, if wanted, just request it. Text [You can skip this section] There's another array called $Text that is defined in the same way than $Url. The whole array is defined at the beginning, making a mysql call and defining all $Text[$i] for current page with a while loop. I'm not sure if this is more efficient than multiple calls for a single mysql cell. Example: $Text['54'] returns "This is just a test array!" which this could perfectly be implemented with a function like text(54). Question With the 3 examples you can see that I use different methods to do almost the same function (no pun intended), but I'm not sure which one should become the standard one for my code. I could create a function called url() and other called text() to output what I want. I think that working with functions in those cases is better, but I'm not sure why. So I'd really appreciate your opinions and advice. Should I mix arrays and functions in the way I described or should I just use funcions? Please, base your answer in this: The source needs to be readable and reusable by other developers Resource consumption (processing, time and memory). The shorter the code the better. The more you explain the reasons the better. Thank you PS, now I know the differences between $Url and $Uri.

    Read the article

  • Linux library that handles both GUI/textual mode user interfaces

    Hello, I am looking for some Linux library/programming language that can be used on a variety of Linux platforms and can operate in both textual and GUI mode interfaces. For example YCP (the Yast programming language) will display in GUI if in Gnome/KDE environment and run in text/ncurses mode when display is not available. The problem is that YCP is SUSE specific. Any ideas will be appreciated!

    Read the article

  • Why did you decide "against" using Erlang?

    - by Zubair
    Have you actually "tried" (means programmed in, not just read an article on it) Erlang and decided against it for a project? If so, why? Also, if you have opted to go back to your old language, or to use another functional language like F#, Haskell, Clojure, Scala, or something else then this counts too, and state why.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to send HTTP POST request and recieve response?

    - by Maxim Kachurovskiy
    For example, I need to make the following Client C - Server S conversation and get XIMSS.nonce node value: C:GET /ximsslogin/ HTTP/1.1 Host: myserver.com Content-Type: text/xml Content-Length: 42 <XIMSS><listFeatures id="list" /><XIMSS> S:HTTP/1.1 200 OK Content-Length: 231 Connection: keep-alive Content-Type: text/xml;charset=utf-8 Server: CommuniGatePro/5.3 <XIMSS><nonce>2C3E575E5498CE63574D40F18D00C873</nonce><language>german</language><response id="s"/></XIMSS>

    Read the article

< Previous Page | 232 233 234 235 236 237 238 239 240 241 242 243  | Next Page >