Search Results

Search found 32072 results on 1283 pages for 'catch unit test'.

Page 287/1283 | < Previous Page | 283 284 285 286 287 288 289 290 291 292 293 294  | Next Page >

  • jQuery and CodeIgniter AJAX with JSON not working

    - by thedp
    Hello, I trying to make my first AJAX with JSON call using jQuery and CodeIgniter. But for some weird reason it's not working. The jQuery code: var item = "COOL!"; $.post("http://192.168.8.138/index.php/main/test", { "item" : item }, function(data){ alert(data.result); }, "json"); The CodeIgniter code: <?php class main extends Controller { function test() { $item = trim($this->input->post('item')); $array = array('result' => $item); echo json_encode($array); } } ?> I tried to access the http://192.168.8.138/index.php/main/test page manually and it seems to be working, I got: {"result":""} I also tried to use Firebug to see XMLHttpRequest but saw nothing. I have no idea what am I doing wrong... Need help really badly. Thank you.

    Read the article

  • PHP Regular Expression

    - by saturngod
    I want to change &lt;lang class='brush:xhtml'&gt;test&lt;/lang&gt; to <pre class='brush:xhtml'>test</pre> my code like that. <?php $content="&lt;lang class='brush:xhtml'&gt;test&lt;/lang&gt;"; $pattern=array(); $replace=array(); $pattern[0]="/&lt;lang class=([A-Za-z='\":])* &lt;/"; $replace[0]="<pre $1>"; $pattern[1]="/&lt;lang&gt;/"; $replace[1]="</pre>"; echo preg_replace($pattern, $replace,$content); ?> but it's not working. How to change my code or something wrong in my code ?

    Read the article

  • Ask Basic Configurator in Apache Commong Log

    - by adisembiring
    I use log4j as logger for my web application. in log4j, I can set the level log in log4j properties or log4j.xml. in log4j, we instance logger as follows: static Logger logger = Logger.getLogger(SomeClass.class); I init log4j basic configurator in a servlet file using init method. But, I usually test application using JUnit, So I init the basic configurator in setup method. after that, I test the application, and I can see the log. Because I deployed, the web in websphere. I change all of logging instance become: private Log log = LogFactory.getLog(Foo.class); I don't know how to load basic configurator using ACL. so I can't control debug level to my JUnit test. do you have any suggestion, without changing static Logger logger = Logger.getLogger(SomeClass.class); become static Logger logger = Logger.getLogger(SomeClass.class);

    Read the article

  • Code changes in the Dtsx file in an SSIS package not reflecting after deploying and running on the server

    - by SKumar
    I have some folder called Test-Deploy in which I keep all the dtsx files, manifest and configuration files. Whenever I want to deploy the ssis package, I run manifest file in this folder and deploy. My problem is I have to change one of the dtsx files out of it. So, I opened only that particular dtsx file BI studio, updated and built. After the build, I copied the dtsx file from bin folder and copied to my Test-Deploy folder. When I deployed and run this new package in the Test-Deploy folder, the changes I made are not reflecting in the result. I could not find any difference in the results before and after changing. My doubt is has it saved my previous dtsx file somewhere on the server and executing the same dtsx file instead of the new one?

    Read the article

  • Parsing JSON file with Python -> google map api

    - by Hannes
    Hi all, I am trying to get started with JSON in Python, but it seems that I misunderstand something in the JSON concept. I followed the google api example, which works fine. But when I change the code to a lower level in the JSON response (as shown below, where I try to get access to the location), I get the following error message for code below: Traceback (most recent call last): File "geoCode.py", line 11, in test = json.dumps([s['location'] for s in jsonResponse['results']], indent=3) KeyError: 'location' How can I get access to lower information level in the JSON file in python? Do I have to go to a higher level and search the result string? That seems very weird to me? Here is the code I have tried to run: import urllib, json URL2 = "http://maps.googleapis.com/maps/api/geocode/json?address=1600+Amphitheatre+Parkway,+Mountain+View,+CA&sensor=false" googleResponse = urllib.urlopen(URL2); jsonResponse = json.loads(googleResponse.read()) test = json.dumps([s['location'] for s in jsonResponse['results']], indent=3) print test Thank you for your responses.

    Read the article

  • Rails: restful authentication setup help

    - by SuperString
    Hi I downloaded the plugin from http://github.com/techweenie/restful-authentication.git Then I run rails generate plugin authenticated user session This is the result I got: create vendor/plugins/authenticated create vendor/plugins/authenticated/MIT-LICENSE create vendor/plugins/authenticated/README create vendor/plugins/authenticated/Rakefile create vendor/plugins/authenticated/init.rb create vendor/plugins/authenticated/install.rb create vendor/plugins/authenticated/uninstall.rb create vendor/plugins/authenticated/lib create vendor/plugins/authenticated/lib/authenticated.rb invoke test_unit inside vendor/plugins/authenticated create test create test/authenticated_test.rb create test/test_helper.rb Then I tried to do rake db:migrate But I got error that says rake tasks in restful-authentication/tasks/auth.rake are deprecated. Use lib/tasks instead. I am new to rails, tried looking online but things seem to be outdated. Please help!

    Read the article

  • MarkupBuilder using list

    - by tathamr
    I am currently using sql.row("statement") and storing to a list. I then am trying to setup my xml file using MarkupBuilder. Is there a better way than iterating over the list poping off an item and then parsing it to add my different column names and values? What is stored by list entry is ID='X' Period='Yearly' Lengh='test' So the XML would be something similar to: <table name='test'> <row> <column name=ID>X</column> <column name=Period>Yearly</column> <column name=Length>test</column> </row> </table>

    Read the article

  • Android: Displaying Video on VideoView

    - by AndroidDev93
    I'm trying to display a video in my sdcard on the video view. Here is my code: String name = Environment.getExternalStorageDirectory() + "/test.mp4"; final VideoView videoView = (VideoView)findViewById(R.id.videoView1); videoView.setOnPreparedListener(new MediaPlayer.OnPreparedListener() { public void onPrepared(MediaPlayer arg0) { videoView.start(); } }); videoView.setVideoPath(name); The file I am trying to open is called test.mp4 and its located within the sdcard folder. I get an error saying the application has unfortunately stopped. I would appreciate it if someone could help me. Thanks. EDIT : I used the debugger and found out that I get an InvocationTargetException. The detailed message says that : Failure delivering result ResultInfo{who=null, request=1001, result=-1, data=Intent { dat=file:///mnt/sdcard/test.mp4 }} to activity : java.lang.NullPointerException EDIT : I looked at the logcat again and it seems to give the error at videoView.setOnPreparedListener(new MediaPlayer.OnPreparedListener() { I'm guessing either videoView or MediaPlayer is null.

    Read the article

  • Have problem understanding the id/name of java bean

    - by symfony
    In an XmlBeanFactory (including ApplicationContext variants), you use the id or name attributes to specify the bean id(s), and at least one id must be specified in one or both of these attributes. Does it mean the following are legal? <bean id="test"> <bean name="test"> But this is illegal: <bean non_idnorname="test"> you may also or instead specify one or more bean ids (separated by a comma (,) or semicolon (;) via the name attribute. Does it mean I can specify multiple ids this way: <bean name="id1;id2,id3"> Can someone convince my doubt?

    Read the article

  • Compare values for audit trail

    - by kagaku
    I'm attempting to develop an audit trail/tracking solution for an existing database written in PLSQL/PHP - however I'm still unsure as of yet on an easy (to implement and maintain) solution for tracking changes to fields/values. For instance, the project tracking portion of the DB APP tracks over 200 fields and ideally I'd like a nice way to show a history of changes, such as: 5/10/2010 - Project 435232 updated by John Doe Changed Project Name (Old: Test Project; New: Super Test Project) Changed Submission Date (Old: 5/10/2010; New: 5/11/2010) Changed Description (Old: This is an example!; New: This is a test example) Essentially for each field (db column) it would output a new line to show the old/new values. So far my current idea is saving the current version of the data to a temporary table, updating the primary table with the new data then loading each row into an array and doing an array compare to determine the differences. This seems a bit convoluted, and if there is an easier method I'd love to know it. Any ideas or suggestions are much appreciated!

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • nul terminating a int array

    - by robUK
    Hello, gcc 4.4.4 c89 I was just experimenting with a int array. And something just came to my mind. Can I nul terminate it. For example, I am using a 0 to nul terminate. However, 0 could well be a valid value in this array. The code below will terminate after the 5. Even though I mean 0 to be a valid number. However, I could specify the size of the array. But in this case, I don't want to this as I am just interested in this particular problem. Many thanks for any advice, #include <stdio.h> static void test(int *p); int main(void) { int arr[] = {30, 450, 14, 5, 0, 10, '\0'}; test(arr); return 0; } static void test(int *p) { while(*p) { printf("Array values [ %d ]\n", *p++); } }

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • Shell script to process files

    - by Harish
    I need to write a Shell Script to process a huge folder of nearly 20 levels.I have to process each and every file and check which files contain lines like select insert update When I mean line it should take the line till I find a semicolon in that file. I should get a result like this C:/test.java select * from dual C:/test.java select * from test C:/test1.java select * from tester C:/test1.java select * from dual and so on.Right now I have a script to read all the files #!bin/ksh FILE=<FILEPATH to be traversed> TEMPFILE=<Location of Temp file> cd $FILE for f in `find . ! -type d`; do cat $FILE/addedText.txt>>$TEMPFILE/newFile.txt cat $f>>$TEMPFILE/newFile.txt rm $f cat $TEMPFILE/newFile.txt>>$f rm $TEMPFILE/newFile.txt done I have very little knowledge of awk and sed to proceed further in reading each file and achieve what I want to.Can anyone help me in this

    Read the article

  • Flash Hates Me. Error #1009: Cannot access a property or method of a null object reference

    - by sol
    I simply create a movie clip, put it on the stage and give it an instance name of char. Here's my document class, simple as can be: public class Test extends MovieClip { public function Test() { char.x = 1315; char.y = 459; addEventListener(Event.ENTER_FRAME, mouseListen); } private function mouseListen(e:Event) { char.x = mouseX; char.y = mouseY; } } And I get this error: TypeError: Error #1009: Cannot access a property or method of a null object reference. at com.me::Test/::mouseListen() How in the world is it possible that it knows what "char" is in the constructor but not in the mouseListen function? What else could it be?

    Read the article

  • Auto-hide JMenuBar

    - by PeterMmm
    When i run the code above the frame's menu bar come up when the mouse moves to the upper part of the window. The problem is when i open the menu but do not select any item and move out the mouse the menu bar get invisible but the items stay on screen. public class Test extends JFrame { public Test() { setLayout(new BorderLayout()); setSize(300, 300); JMenuBar mb = new JMenuBar(); setJMenuBar(mb); mb.setVisible(false); JMenu menu = new JMenu("File"); mb.add(menu); menu.add(new JMenuItem("Item-1")); menu.add(new JMenuItem("Item-2")); addMouseMotionListener(new MouseAdapter() { @Override public void mouseMoved(MouseEvent e) { getJMenuBar().setVisible(e.getY() < 50); } }); } public static void main(String args[]) { new Test().setVisible(true); } }

    Read the article

  • iPhone, JQTouch and HTML5 audio tags

    - by Moo
    I am having an issue with JQTouch (latest beta) and html5 audio tags on 'sub pages' - the audio tag works before any page transitions are done, and cease to work afterward. For example: http://richardprice.dyndns.ws/test.html and http://richardprice.dyndns.ws/test2.html are identical other than I swap the "current" class between the two divs - all the audio tags play the same mp3. On test.html the audio tag on the initial page works, but when you switch to Page 2 the audio tag on that page does not (and sometimes results in a browser crash). Switch back to Page 1 and the audio tag on that page has ceased to work. test2.html is the same test but with the initial pages reversed, and the same thing happens - Page 2 (now the initial page) plays the audio, Page 1 does not, and switching back to Page 2 results in the audio no longer working. Thoughts?

    Read the article

  • MVC MapPageRoute and ActionLink

    - by Dismissile
    I have created a page route so I can integrate my MVC application with a few WebForms pages that exist in my project: public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); // register the report routes routes.MapPageRoute("ReportTest", "reports/test", "~/WebForms/Test.aspx" ); routes.MapRoute( "Default", // Route name "{controller}/{action}/{id}", // URL with parameters new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); } This has created a problem whenever I use Html.ActionLink in my Views: <%: Html.ActionLink("Home", "Index", "Home") %> When I load the page in the browser the link appears like: http://localhost:12345/reports/test?action=Index&controller=Home Has anyone run into this before? How can I fix this?

    Read the article

  • Bash: Check if file was modified since used in script

    - by Thomas Münz
    I need to check in a script if a file was modified since I read it (another application can modify it in between). According to bash manual there is a "-N" test which should report if a file was modified since last read. I tried it in a small script but it seems like it doesn't work. #!/bin/bash file="test.txt" echo "test" > $file cat $file; if [ -N $file ]; then echo "modified since read"; else echo "not modified since read"; fi I also tried an alternative way by touching another file and using if [ "file1" -nt "file2 ]; but this works only on a seconds accuracy which may under rare conditions not be sufficient. Is there any other bash-inbuilt solution for this problem or I do really need to use diff or md5sum?

    Read the article

  • Setting up functional Tests in Flex

    - by Dan Monego
    I'm setting up a functional test suite for an application that loads an external configuration file. Right now, I'm using flexunit's addAsync function to load it and then again to test if the contents point to services that exist and can be accessed. The trouble with this is that having this kind of two (or more) stage method means that I'm running all of my tests in the context of one test with dozens of asserts, which seems like a kind of degenerate way to use the framework, and makes bugs harder to find. Is there a way to have something like an asynchronous setup? Is there another testing framework that handles this better?

    Read the article

  • Simple vector program error

    - by Codeguru
    Hi iam new to c++ and iam trying out this vector program and i am getting the following error: error: conversion from test*' to non-scalar typetest' requested| Here is the code include include include include using namespace std; class test{ string s; vector <string> v; public: void read(){ ifstream in ("c://test.txt"); while(getline(in,s)) { v.push_back(s); } for(int i=0;i<v.size();i++) { cout<<v[i]<<"\n"; } } }; int main() { cout<<"Opening the file to read and displaying on the screen"< }

    Read the article

  • how to pass url in mailto's body

    - by Simer
    i need to send a url of my site in body so that user can click on that to join my site. but it is coming like this in mail client: Link goes here http://www.example.com/foo.php?this=a url after & is not coming then whole process of joining failed. how can i pass url like these in mailto body http://www.example.com/foo.php?this=a&join=abc&user454 <a href="mailto:[email protected]?body=Link goes here http://www.example.com/foo.php?this=a&amp;really=long&amp;url=with&amp;lots=and&amp;lots=and&amp;lots=of&prameters=on_it ">Link text goes here</a> i have searched alot but did't got right answer thanks

    Read the article

  • IIS 6.0 - ASP Error 0126 Include file not found

    - by André
    Hello, I have a Win Sever 2003 running IIS 6.0 which has only my main website on it and now I am trying to setup a test website which currently is an exact duplicate of the main site. When accessing my main site everything works fine, and has done for a long time. If I access the test site (through 'test.' subdomain) I get this error: Active Server Pages error 'ASP 0126' Include file not found /html/shop/asp/admin/inc/incWeeklySpecialswide3.asp, line 71 The include file '/html/asp/quickfindwithSuburbs31.asp' was not found. The file actually exists, and the paths are correct. I have enabled Parent Paths, replaced the include file path to the full path (http://foo.com/html/asp -etc.), removing the ' / ' at the start of the path and changing the code from ' include ' to ' virtual '. Thanks in advance.

    Read the article

  • Strange execution of get accesor in c#?

    - by Kenji Kina
    I set up a simple program just to test how the code inside a get accessor executes (since I had been having some issues in another project), and found something quite strange: class Program { static void Main(string[] args) { var test = new TestClass(); var testBool = test.TestBool; } } public class TestClass { private bool _testBool = true; public bool TestBool { get { if (_testBool) { Console.WriteLine("true!"); } else { Console.WriteLine("false! WTF!"); } _testBool = false; return _testBool; } } } I expected the output to be true! But what I got instead was true! false! WTF! Just what is going on here?

    Read the article

< Previous Page | 283 284 285 286 287 288 289 290 291 292 293 294  | Next Page >