Search Results

Search found 21947 results on 878 pages for 'static import'.

Page 291/878 | < Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >

  • multiline gtk.Label ignores xalign=0.5

    - by thomas
    A gtk.Label can't be aligned in center when line-wrap is turned on. Example code: import pygtk pygtk.require('2.0') import gtk class testwin(gtk.Window): def __init__(self): gtk.Window.__init__(self) width,height = 300,300 self.set_size_request(width,height) self.set_position(gtk.WIN_POS_CENTER) self.set_title("test window") label = gtk.Label("test text") label.set_line_wrap(True) label.set_justify(gtk.JUSTIFY_CENTER) label.set_alignment(0.5,0.5) label.connect("size-allocate",lambda l,s: l.set_size_request(s.width-1, -1)) self.add(label) self.connect("destroy", gtk.main_quit) self.show_all() testwin() gtk.main() It looks like this, that means, it's aligned left: http://m45.img-up.net/?up=pic122x97.png If you comment out line 14 (set_line_wrap) everything is perfectly fine: http://o54.img-up.net/?up=pic2y00p9.png Please note that yalign works fine. So it seems like the first argument in the gtk.Misc.set_alignment-function has no effect when line wrap is turned on. Using Fedora 16, 64bit, gtk 3.2.4, pygtk 2.24.0, python 2.7.2 Question: Is this intended or a bug? How is it supposed to be made or is a workaround available?

    Read the article

  • red black tree balancing?

    - by Anirudh Kaki
    i am working to generate tango tree, where i need to check whether every sub tree in tango is balanced or not. if its not balanced i need to make it balance? I trying so hard to make entire RB-tree balance but i not getting any proper logic so can any one help me out?? here i am adding code to check how to find my tree is balanced are not but when its not balanced how can i make it balance. static boolean verifyProperty5(rbnode n) { int left = 0, right = 0; if (n != null) { bh++; left = blackHeight(n.left, 0); right = blackHeight(n.right, 0); } if (left == right) { System.out.println("black height is :: " + bh); return true; } else { System.out.println("in balance"); return false; } } public static int blackHeight(rbnode root, int len) { bh = 0; blackHeight(root, path1, len); return bh; } private static void blackHeight(rbnode root, int path1[], int len) { if (root == null) return; if (root.color == "black"){ root.black_count = root.parent.black_count+1; } else{ root.black_count = root.parent.black_count; } if ((root.left == null) && (root.right == null)) { bh = root.black_count; } blackHeight(root.left, path1, len); blackHeight(root.right, path1, len); }

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • MSTest unit test passes by itself, fails when other tests are run

    - by Sarah Vessels
    I'm having trouble with some MSTest unit tests that pass when I run them individually but fail when I run the entire unit test class. The tests test some code that SLaks helped me with earlier, and he warned me what I was doing wasn't thread-safe. However, now my code is more complicated and I don't know how to go about making it thread-safe. Here's what I have: public static class DLLConfig { private static string _domain; public static string Domain { get { return _domain = AlwaysReadFromFile ? readCredentialFromFile(DOMAIN_TAG) : _domain ?? readCredentialFromFile(DOMAIN_TAG); } } } And my test is simple: string expected = "the value I know exists in the file"; string actual = DLLConfig.Domain; Assert.AreEqual(expected, actual); When I run this test by itself, it passes. When I run it alongside all the other tests in the test class (which perform similar checks on different properties), actual is null and the test fails. I note this is not a problem with a property whose type is a custom Enum type; maybe I'm having this problem with the Domain property because it is a string? Or maybe it's a multi-threaded issue with how MSTest works?

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • How do I create an OpenCV image from a PIL image?

    - by scrible
    I want to do some image processing with OpenCV (in Python), but I have to start with a PIL Image object, so I can't use the cvLoadImage() call, since that takes a filename. This recipe (adapted from http://opencv.willowgarage.com/wiki/PythonInterface) does not work because cvSetData complains argument 2 of type 'void *' . Any ideas? from opencv.cv import * from PIL import Image pi = Image.open('foo.png') # PIL image ci = cvCreateImage(pi.size, IPL_DEPTH_8U, 1) # OpenCV image data = pi.tostring() cvSetData(ci, data, len(data)) I think the last argument to the cvSetData is wrong too, but I am not sure what it should be.

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • Is this GetEnumAsStrings<T>() method reinventing the wheel?

    - by Edward Tanguay
    I have a number of enums and need to get them as List<string> objects in order to enumerate through them and hence made the GetEnumAsStrings<T>() method. But it seems to me there would be an easier way. Is there not a built-in method to get an enum like this into a List<string>? using System; using System.Collections.Generic; namespace TestEnumForeach2312 { class Program { static void Main(string[] args) { List<string> testModes = StringHelpers.GetEnumAsStrings<TestModes>(); testModes.ForEach(s => Console.WriteLine(s)); Console.ReadLine(); } } public static class StringHelpers { public static List<string> GetEnumAsStrings<T>() { List<string> enumNames = new List<string>(); foreach (T item in Enum.GetValues(typeof(TestModes))) { enumNames.Add(item.ToString()); } return enumNames; } } public enum TestModes { Test, Show, Wait, Stop } }

    Read the article

  • Java "compare cannot be resolved to a type" error

    - by King Triumph
    I'm getting a strange error when attempting to use a comparator with a binary search on an array. The error states that "compareArtist cannot be resolved to a type" and is thrown by Eclipse on this code: Comparator<Song> compare = new Song.compareArtist(); I've done some searching and found references to a possible bug with Eclipse, although I have tried the code on a different computer and the error persists. I've also found similar issues regarding the capitalization of the compare method, in this case compareArtist. I've seen examples where the first word in the method name is capitalized, although it was my understanding that method names are traditionally started with a lower case letter. I have experimented with changing the capitalization but nothing has changed. I have also found references to this error if the class doesn't import the correct package. I have imported java.util in both classes in question, which to my knowledge allows the use of the Comparator. I've experimented with writing the compareArtist method within the class that has the binary search call as well as in the "Song" class, which according to my homework assignment is where it should be. I've changed the constructor accordingly and the issue persists. Lastly, I've attempted to override the Comparator compare method by implementing Comparator in the Song class and creating my own method called "compare". This returns the same error. I've only moved to calling the comparator method something different than "compare" after finding several examples that do the same. Here is the relevant code for the class that calls the binary search that uses the comparator. This code also has a local version of the compareArtist method. While it is not being called currently, the code for this method is the same as the in the class Song, where I am trying to call it from. Thanks for any advice and insight. import java.io.*; import java.util.*; public class SearchByArtistPrefix { private Song[] songs; // keep a direct reference to the song array private Song[] searchResults; // holds the results of the search private ArrayList<Song> searchList = new ArrayList<Song>(); // hold results of search while being populated. Converted to searchResults array. public SearchByArtistPrefix(SongCollection sc) { songs = sc.getAllSongs(); } public int compareArtist (Song firstSong, Song secondSong) { return firstSong.getArtist().compareTo(secondSong.getArtist()); } public Song[] search(String artistPrefix) { String artistInput = artistPrefix; int searchLength = artistInput.length(); Song searchSong = new Song(artistInput, "", ""); Comparator<Song> compare = new Song.compareArtist(); int search = Arrays.binarySearch(songs, searchSong, compare);

    Read the article

  • Existing LINQ extension method similar to Parallel.For?

    - by Joel Martinez
    The linq extension methods for ienumerable are very handy ... but not that useful if all you want to do is apply some computation to each item in the enumeration without returning anything. So I was wondering if perhaps I was just missing the right method, or if it truly doesn't exist as I'd rather use a built-in version if it's available ... but I haven't found one :-) I could have sworn there was a .ForEach method somewhere, but I have yet to find it. In the meantime, I did write my own version in case it's useful for anyone else: using System.Collections; using System.Collections.Generic; public delegate void Function<T>(T item); public delegate void Function(object item); public static class EnumerableExtensions { public static void For(this IEnumerable enumerable, Function func) { foreach (object item in enumerable) { func(item); } } public static void For<T>(this IEnumerable<T> enumerable, Function<T> func) { foreach (T item in enumerable) { func(item); } } } usage is: myEnumerable.For<MyClass>(delegate(MyClass item) { item.Count++; });

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • Excel Automation Addin UDFs not accesible

    - by Eric
    I created the following automation addin: namespace AutomationAddin { [Guid("6652EC43-B48C-428a-A32A-5F2E89B9F305")] [ClassInterface(ClassInterfaceType.AutoDual)] [ComVisible(true)] public class MyFunctions { public MyFunctions() { } #region UDFs public string ToUpperCase(string input) { return input.ToUpper(); } #endregion [ComRegisterFunctionAttribute] public static void RegisterFunction(Type type) { Registry.ClassesRoot.CreateSubKey( GetSubKeyName(type, "Programmable")); RegistryKey key = Registry.ClassesRoot.OpenSubKey( GetSubKeyName(type, "InprocServer32"), true); key.SetValue("", System.Environment.SystemDirectory + @"\mscoree.dll", RegistryValueKind.String); } [ComUnregisterFunctionAttribute] public static void UnregisterFunction(Type type) { Registry.ClassesRoot.DeleteSubKey( GetSubKeyName(type, "Programmable"), false); } private static string GetSubKeyName(Type type, string subKeyName) { System.Text.StringBuilder s = new System.Text.StringBuilder(); s.Append(@"CLSID\{"); s.Append(type.GUID.ToString().ToUpper()); s.Append(@"}\"); s.Append(subKeyName); return s.ToString(); } } } I build it and it registers just fine. I open excel 2003, go to tools-Add-ins, click on the automation button and the addin appears in the list. I add it and it shows up in the addins list. but, the functions themselves don't appear. If I type it in it doesn't work and if I look in the function wizard, my addin doesn't show up as a category and the functions are not in the list. I am using excel 2003 on windows 7 x86. I built the project with visual studio 2010. This addin worked fine on windows xp built with visual studio 2008.

    Read the article

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

  • fastest in-memory cache for XslCompiledTransform

    - by rudnev
    I have a set of xslt stylesheet files. I need to produce the fastest performance of XslConpiledTransform, so i want to make in-memory representation of these stylesheets. I can load them to in-memory collection as IXpathNavigable on application start, and then load each IXPAthNavigable into singleton XslCompiledTransform on each request. But this works only for styleshhets without xsl:import or xsl:include. (Xsl:import is only for files). also i can load into cache many instances of XSLCompiledTransform for each template. Is it reasonable? Are there other ways? What is the best? what are another tips for improving performance MS Xslt processor?

    Read the article

  • Raising C# events with an extension method - is it bad?

    - by Kyralessa
    We're all familiar with the horror that is C# event declaration. To ensure thread-safety, the standard is to write something like this: public event EventHandler SomethingHappened; protected virtual void OnSomethingHappened(EventArgs e) { var handler = SomethingHappened; if (handler != null) handler(this, e); } Recently in some other question on this board (which I can't find now), someone pointed out that extension methods could be used nicely in this scenario. Here's one way to do it: static public class EventExtensions { static public void RaiseEvent(this EventHandler @event, object sender, EventArgs e) { var handler = @event; if (handler != null) handler(sender, e); } static public void RaiseEvent<T>(this EventHandler<T> @event, object sender, T e) where T : EventArgs { var handler = @event; if (handler != null) handler(sender, e); } } With these extension methods in place, all you need to declare and raise an event is something like this: public event EventHandler SomethingHappened; void SomeMethod() { this.SomethingHappened.RaiseEvent(this, EventArgs.Empty); } My question: Is this a good idea? Are we missing anything by not having the standard On method? (One thing I notice is that it doesn't work with events that have explicit add/remove code.)

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Custom webserver caching

    - by Mark Kinsella
    I'm working with a custom webserver on an embedded system and having some problems correctly setting my HTTP Headers for caching. Our webserver is generating all dynamic content as XML and we're using semi-static XSL files to display it with some dynamic JSON requests thrown in for good measure along with semi-static images. I say "semi-static" because the problems occur when we need to do a firmware update which might change the XSL and image files. Here's what needs to be done: cache the XSL and image files and do not cache the XML and JSON responses. I have full control over the HTTP response and am currently: Using ETags with the XSL and image files, using the modified time and size to generate the ETag Setting Cache-Control: no-cache on the XML and JSON responses As I said, everything works dandy until a firmware update when the XSL and image files are sometimes cached. I've seen it work fine with the latest versions of Firefox and Safari but have had some problems with IE. I know one solution to this problem would be simply rename the XSL and image files after each version (eg. logo-v1.1.png, logo-v1.2.png) and set the Expires header to a date in the future but this would be difficult with the XSL files and I'd like to avoid this. Note: There is a clock on the unit but requires the user to set it and might not be 100% reliable which is what might be causing my caching issues when using ETags. What's the best practice that I should employ? I'd like to avoid as many webserver requests as possible but invalidating old XSL and image files after a software update is the #1 priority.

    Read the article

< Previous Page | 287 288 289 290 291 292 293 294 295 296 297 298  | Next Page >