Search Results

Search found 21947 results on 878 pages for 'static import'.

Page 292/878 | < Previous Page | 288 289 290 291 292 293 294 295 296 297 298 299  | Next Page >

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • return an ArrayList method

    - by Bopeng Liu
    This is a drive method for two other classes. which i posted here http://codereview.stackexchange.com/questions/33148/book-program-with-arraylist I need some help for the private static ArrayList getAuthors(String authors) method. I am kind a beginner. so please help me finish this drive method. or give me some directions. Instruction some of the elements of the allAuthors array contain asterisks “*” between two authors names. The getAuthors method uses this asterisk as a delimiter between names to store them separately in the returned ArrayList of Strings. import java.util.ArrayList; public class LibraryDrive { public static void main(String[] args) { String[] titles = { "The Hobbit", "Acer Dumpling", "A Christmas Carol", "Marley and Me", "Building Java Programs", "Java, How to Program" }; String[] allAuthors = { "Tolkien, J.R.", "Doofus, Robert", "Dickens, Charles", "Remember, SomeoneIdont", "Reges, Stuart*Stepp, Marty", "Deitel, Paul*Deitel, Harvery" }; ArrayList<String> authors = new ArrayList<String>(); ArrayList<Book> books = new ArrayList<Book>(); for (int i = 0; i < titles.length; i++) { authors = getAuthors(allAuthors[i]); Book b = new Book(titles[i], authors); books.add(b); authors.remove(0); } Library lib = new Library(books); System.out.println(lib); lib.sort(); System.out.println(lib); } private static ArrayList<String> getAuthors(String authors) { ArrayList books = new ArrayList<String>(); // need help here. return books; } }

    Read the article

  • How do I sign requests reliably for the Last.fm api in C#?

    - by Arda Xi
    I'm trying to implement authorization through Last.fm. I'm submitting my arguments as a Dictionary to make the signing easier. This is the code I'm using to sign my calls: public static string SignCall(Dictionary<string, string> args) { IOrderedEnumerable<KeyValuePair<string, string>> sortedArgs = args.OrderBy(arg => arg.Key); string signature = sortedArgs.Select(pair => pair.Key + pair.Value). Aggregate((first, second) => first + second); return MD5(signature + SecretKey); } I've checked the output in the debugger, it's exactly how it should be, however, I'm still getting WebExceptions every time I try. Here's my code I use to generate the URL in case it'll help: public static string GetSignedURI(Dictionary<string, string> args, bool get) { var stringBuilder = new StringBuilder(); if (get) stringBuilder.Append("http://ws.audioscrobbler.com/2.0/?"); foreach (var kvp in args) stringBuilder.AppendFormat("{0}={1}&", kvp.Key, kvp.Value); stringBuilder.Append("api_sig="+SignCall(args)); return stringBuilder.ToString(); } And sample usage to get a SessionKey: var args = new Dictionary<string, string> { {"method", "auth.getSession"}, {"api_key", ApiKey}, {"token", token} }; string url = GetSignedURI(args, true); EDIT: Oh, and the code references an MD5 function implemented like this: public static string MD5(string toHash) { byte[] textBytes = Encoding.UTF8.GetBytes(toHash); var cryptHandler = new System.Security.Cryptography.MD5CryptoServiceProvider(); byte[] hash = cryptHandler.ComputeHash(textBytes); return hash.Aggregate("", (current, a) => current + a.ToString("x2")); }

    Read the article

  • Multi-part template issue with Jinja2

    - by Alan Harris-Reid
    Hi, When creating templates I typically have 3 separate parts (header, body, footer) which I combine to pass a singe string to the web-server (CherryPy in this case). My first approach is as follows... from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template('Body.html') page_body = tmpl.render() tmpl = env.get_template('Header.html') page_header = tmpl.render() tmpl = env.get_template('Footer.html') page_footer = tmpl.render() page_code = page_header + page_body + page_footer but this contains repetitious code, so my next approach is... def render_template(html_file): from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template(html_file) return tmpl.render() page_header = render_template('Header.html') page_body = render_template('Body.html') page_footer = render_template('Footer.html) However, this means that each part is created in its own environment - can that be a problem? Are there any other downsides to this approach? I have chosen the 3-part approach over the child-template approach because I think it may be more flexible (and easier to follow), but I might be wrong. Anyone like to convince me that using header, body and footer blocks might be better? Any advice would be appreciated. Alan

    Read the article

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • MovieViewControl unable to become a receiver during Broadcast

    - by Paulina D
    Hi! I'm currently trying to catch a broadcast message with the MovieViewControl class, already added the filter in the Manifest //In MovieViewControl private static final String SERVICECMD = "com.android.music.musicservicecommand"; private static final String CMDNAME = "command"; private static final String CMDPAUSE = "pause"; @Override public void onReceive(Context context, Intent intent) { String intentAction = intent.getAction(); if (AudioManager.ACTION_AUDIO_BECOMING_NOISY.equals(intentAction)) { Intent i = new Intent(intent.ACTION_MAIN); i.setAction(SERVICECMD); i.putExtra(CMDNAME, CMDPAUSE); mVideoView.pause(); context.startActivity(i); } } but when I do my trial, I get this (very) huge exception: W/dalvikvm( 1630): threadid=3: thread exiting with uncaught exception (group=0x4001b1b8) E/AndroidRuntime( 1630): Uncaught handler: thread main exiting due to uncaught exception E/AndroidRuntime( 1630): java.lang.RuntimeException: Unable to instantiate receiver com.android.gallery.MovieViewControl: java.lang.ClassNotFoundException: com.android.gallery.MovieViewControl in loader dalvik.system.PathClassLoader@438ff048 E/AndroidRuntime( 1630): at android.app.ActivityThread.handleReceiver(ActivityThread.java:2616) E/AndroidRuntime( 1630): at android.app.ActivityThread.access$3100(ActivityThread.java:119) E/AndroidRuntime( 1630): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1913) E/AndroidRuntime( 1630): at android.os.Handler.dispatchMessage(Handler.java:99) E/AndroidRuntime( 1630): at android.os.Looper.loop(Looper.java:123) E/AndroidRuntime( 1630): at android.app.ActivityThread.main(ActivityThread.java:4363) E/AndroidRuntime( 1630): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime( 1630): at java.lang.reflect.Method.invoke(Method.java:521) E/AndroidRuntime( 1630): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) E/AndroidRuntime( 1630): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) E/AndroidRuntime( 1630): at dalvik.system.NativeStart.main(Native Method) E/AndroidRuntime( 1630): Caused by: java.lang.ClassNotFoundException: com.android.gallery.MovieViewControl in loader dalvik.system.PathClassLoader@438ff048 E/AndroidRuntime( 1630): at dalvik.system.PathClassLoader.findClass(PathClassLoader.java:243) E/AndroidRuntime( 1630): at java.lang.ClassLoader.loadClass(ClassLoader.java:573) E/AndroidRuntime( 1630): at java.lang.ClassLoader.loadClass(ClassLoader.java:532) E/AndroidRuntime( 1630): at android.app.ActivityThread.handleReceiver(ActivityThread.java:2609) E/AndroidRuntime( 1630): ... 10 more Any hints on what might I be missing? Thanks in advance!

    Read the article

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • read subprocess stdout line by line

    - by Caspin
    My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • jcuda library usage problem

    - by user513164
    hi m very new to java and Linux i have a code which is taken from examples of jcuda.the code is following import jcuda.CUDA; import jcuda.driver.CUdevprop; import jcuda.driver.types.CUdevice; public class EnumDevices { public static void main(String args[]) { //Init CUDA Driver CUDA cuda = new CUDA(true); int count = cuda.getDeviceCount(); System.out.println("Total number of devices: " + count); for (int i = 0; i < count; i++) { CUdevice dev = cuda.getDevice(i); String name = cuda.getDeviceName(dev); System.out.println("Name: " + name); int version[] = cuda.getDeviceComputeCapability(dev); System.out.println("Version: " + String.format("%d.%d", version[0], version[1])); CUdevprop prop = cuda.getDeviceProperties(dev); System.out.println("Clock rate: " + prop.clockRate + " MHz"); System.out.println("Threads per block: " + prop.maxThreadsPerBlock); } } } I'm using Ubuntu as my operating system i compiled it with following command 1:-javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices i got following error error: Class names, 'EnumDevices', are only accepted if annotation processing is explicitly requested 1 error i don't know what is the meaning of this error.what should i do to compile the program than i changed the compiling option which is javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices.java than i got following error EnumDevices.java:36: clockRate is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Clock rate: " + prop.clockRate + " MHz"); ^ EnumDevices.java:37: maxThreadsPerBlock is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Threads per block: " + prop.maxThreadsPerBlock); ^ 2 errors Now I'm completely confused i don't know what to do? how to compile this program ? how to install the jcuda package or how to use it ? how to use package which have only jar files and .so files and the jar files don't having manifest file ? please help me

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Flip clock showing time issue (animations invovled)

    - by Hwang
    I'm creating a flip clock (clock where you always see in airport), but I can't seems to get the time to show at the correct timing. After the flip, then will see the number changing. But I want it to change before it flips. Currently I'm not sure whether is the animation problem, or isit I have to do something else on the script. I've uploaded the FLA so that you could have a look on how I set up the flipping animation. http://www.mediafire.com/?nzmymjgtntz Below is the AS3 code: package { import flash.display.MovieClip; import flash.events.TimerEvent; import flash.utils.Timer; public class flipClock extends MovieClip { private var clock:clockMC=new clockMC(); //seconds private var secTop1=clock.second.top1.digit; private var secTop2=clock.second.top2.digit; private var secBot1=clock.second.bot1.digit; private var secBot2=clock.second.bot2.digit; private var seconds:Number; private var minutes:Number; private var hours:Number; private var days:Number; public function flipClock():void { decrease(); addChild(clock); } private function decrease():void { var countdownTimer:Timer=new Timer(1000); //Adding an event listener to the timer object countdownTimer.addEventListener(TimerEvent.TIMER,updateTime); //Initializing timer object countdownTimer.start(); } private function updateTime(event:TimerEvent):void { decreasTimerFunction(); updateSecond(); //updateMinute(); } private function updateSecond():void { clock.second.play(); secTop1.text=num2; secTop2.text=num1; if (num1<10) { num1="0"+num1; } if (num2<10) { num2="0"+num2; } if (num1==60) { num1=0; } if (num2==60) { num2=0; } secTop1.text=num1; secTop2.text=num2; //secBot1.text=num1; //secBot2.text=num2; } private function decreasTimerFunction():void { //Create a date object for Christmas Morning var endTime:Date=new Date(2010,4,26,0,0,0,0); //Current date object var now:Date=new Date(); // Set the difference between the two date and times in milliseconds var timeDiff:Number=endTime.getTime()-now.getTime(); seconds=Math.floor(timeDiff/1000); minutes=Math.floor(seconds/60); hours=Math.floor(minutes/60); days=Math.floor(hours/24); // Set the remainder of the division vars above hours%=24; minutes%=60; seconds%=60; } } }

    Read the article

  • Is there any Java Decompiler that can correctly decompile calls to overloaded methods?

    - by mihi
    Consider this (IMHO simple) example: public class DecompilerTest { public static void main(String[] args) { Object s1 = "The", s2 = "answer"; doPrint((Object) "You should know:"); for (int i = 0; i < 2; i++) { doPrint(s1); doPrint(s2); s1 = "is"; s2 = new Integer(42); } System.out.println(); } private static void doPrint(String s1) { System.out.print("Wrong!"); } private static void doPrint(Object s1) { System.out.print(s1 + " "); } } Compile it with source/target level 1.1 without debug information (i.e. no local variable information should be present) and try to decompile it. I tried Jad, JD-GUI and Fernflower, and all of them got at least one of the call wrong (i. e. the program printed "Wrong!" at least once) Is there really no java decompiler that can infer the right casts so that it will not call the wrong overload?

    Read the article

  • iPhone: error: request for member 'table' in something not a structure or union

    - by Jack Griffiths
    Hi there, When it comes to compiling my application, I get the error mentioned in the title. How would I go about remedying this error? Basically, I want to get from one table to the other. Hierarchy, navigation. NextViewController.m #import "RootViewController.h" #import "NextViewController.h" @implementation NextViewController - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Releases the view if it doesn't have a superview // Release anything that's not essential, such as cached data } - (void)dealloc { [super dealloc]; } - (IBAction) changeTable:(NSString *)str{ tblCSS.table = str; } The last line contains the error. If you need any more code, just ask. I'll amend this post with it. Cheers, Jack

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • How to get progress bar to time Class exectution

    - by chrissygormley
    Hello, I am trying to use progress bar to show the progress of a script. I want it increase progress after every function in a class is executed. The code I have tried is below: import progressbar from time import sleep class hello(): def no(self): print 'hello!' def yes(self): print 'No!!!!!!' def pro(): bar = progressbar.ProgressBar(widgets=[progressbar.Bar('=', '[', ']'), ' ', progressbar.Percentage()]) for i in Yep(): bar.update(Yep.i()) sleep(0.1) bar.finish() if __name__ == "__main__": Yep = hello() pro() Does anyone know how to get this working. Thanks

    Read the article

  • Importing a spreadsheet into an asp.net program and listing the worksheets

    - by Bob Avallone
    I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

    Read the article

  • How can I set controls for a web page ??

    - by Rami Jarrar
    I have this login page with https, and i reach to this approach:: import ClientForm import urllib2 request = urllib2.Request("http://ritaj.birzeit.edu") response = urllib2.urlopen(request) forms = ClientForms.ParseResponseEx(response) response.close() f = forms[0] username = str(raw_input("Username: ")) password = str(raw_input("Password: ")) ## Here What To Do request2 = form.click() i get the controls of that page >>> f = forms[0] >>> [c.name for c in f.controls] ['q', 'sitesearch', 'sa', 'domains', 'form:mode', 'form:id', '__confirmed_p', '__refreshing_p', 'return_url', 'time', 'token_id', 'hash', 'username', 'password', 'persistent_p', 'formbutton:ok'] so how can i set the username and password controls of the "non-form form" f ??? and i have another problem,, how to know if its the right username and password ??

    Read the article

  • Do fluent interfaces significantly impact runtime performance of a .NET application?

    - by stakx
    I'm currently occupying myself with implementing a fluent interface for an existing technology, which would allow code similar to the following snippet: using (var directory = Open.Directory(@"path\to\some\directory")) { using (var file = Open.File("foobar.html").In(directory)) { // ... } } In order to implement such constructs, classes are needed that accumulate arguments and pass them on to other objects. For example, to implement the Open.File(...).In(...) construct, you would need two classes: // handles 'Open.XXX': public static class OpenPhrase { // handles 'Open.File(XXX)': public static OpenFilePhrase File(string filename) { return new OpenFilePhrase(filename); } // handles 'Open.Directory(XXX)': public static DirectoryObject Directory(string path) { // ... } } // handles 'Open.File(XXX).XXX': public class OpenFilePhrase { internal OpenFilePhrase(string filename) { _filename = filename } // handles 'Open.File(XXX).In(XXX): public FileObject In(DirectoryObject directory) { // ... } private readonly string _filename; } That is, the more constituent parts statements such as the initial examples have, the more objects need to be created for passing on arguments to subsequent objects in the chain until the actual statement can finally execute. Question: I am interested in some opinions: Does a fluent interface which is implemented using the above technique significantly impact the runtime performance of an application that uses it? With runtime performance, I refer to both speed and memory usage aspects. Bear in mind that a potentially large number of temporary, argument-saving objects would have to be created for only very brief timespans, which I assume may put a certain pressure on the garbage collector. If you think there is significant performance impact, do you know of a better way to implement fluent interfaces?

    Read the article

  • How to use less memory while running a task in Symfony 1.4?

    - by Guillaume Flandre
    I'm using Symfony 1.4 and Doctrine. So far I had no problem running tasks with Symfony. But now that I have to import a pretty big amount of data and save them in the database, I get the infamous "Fatal Error: Allowed memory size of XXXX bytes exhausted" During this import I'm only creating new objects, setting a few fields and saving them. I'm pretty sure it has something to do with the number of objects I'm creating when saving data. Unsetting those objects doesn't do anything though. Are there any best practices to limit memory usage in Symfony?

    Read the article

  • Understanding Java Wait and Notify methods

    - by Maddy
    Hello all: I have a following program: import java.util.concurrent.ExecutorService; import java.util.concurrent.Executors; public class SimpleWaitNotify implements Runnable { final static Object obj = new Object(); static boolean value = true; public synchronized void flag() { System.out.println("Before Wait"); try { obj.wait(); } catch (InterruptedException e) { System.out.println("Thread interrupted"); } System.out.println("After Being Notified"); } public synchronized void unflag() { System.out.println("Before Notify All"); obj.notifyAll(); System.out.println("After Notify All Method Call"); } public void run() { if (value) { flag(); } else { unflag(); } } public static void main(String[] args) throws InterruptedException { ExecutorService pool = Executors.newFixedThreadPool(4); SimpleWaitNotify sWait = new SimpleWaitNotify(); pool.execute(sWait); SimpleWaitNotify.value = false; SimpleWaitNotify sNotify = new SimpleWaitNotify(); pool.execute(sNotify); pool.shutdown(); } } When I wait on obj, I get the following exception Exception in thread "pool-1-thread-1" java.lang.IllegalMonitorStateException: current thread not owner for each of the two threads. But if I use SimpleWaitNotify's monitor then the program execution is suspended. In other words, I think it suspends current execution thread and in turn the executor. Any help towards understanding what's going on would be duly appreciated. This is an area1 where the theory and javadoc seem straightforward, and since there aren't many examples, conceptually left a big gap in me.

    Read the article

  • Complex sound handling (I.E. pitch change while looping)

    - by Matthew
    Hi everyone I've been meaning to learn Java for a while now (I usually keep myself in languages like C and Lua) but buying an android phone seems like an excellent time to start. now after going through the lovely set of tutorials and a while spent buried in source code I'm beginning to get the feel for it so what's my next step? well to dive in with a fully featured application with graphics, sound, sensor use, touch response and a full menu. hmm now there's a slight conundrum since i can continue to use cryptic references to my project or risk telling you what the application is but at the same time its going to make me look like a raving sci-fi nerd so bare with me for the brief... A semi-working sonic screwdriver (oh yes!) my grand idea was to make an animated screwdriver where sliding the controls up and down modulate the frequency and that frequency dictates the sensor data it returns. now I have a semi-working sound system but its pretty poor for what its designed to represent and I just wouldn't be happy producing a sub-par end product whether its my first or not. the problem : sound must begin looping when the user presses down on the control the sound must stop when the user releases the control when moving the control up or down the sound effect must change pitch accordingly if the user doesn't remove there finger before backing out of the application it must plate the casing of there device with gold (Easter egg ;P) now I'm aware of how monolithic the first 3 look and that's why I would really appreciate any help I can get. sorry for how bad this code looks but my general plan is to create the functional components then refine the code later, no good painting the walls if the roofs not finished. here's my user input, he set slide stuff is used in the graphics for the control @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); //this is from my latest attempt at loop pitch change, look for this in my soundPool class mSonicAudio.startLoopedSound(); } } if(event.getAction() == MotionEvent.ACTION_MOVE) { if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); setSlideY ( (int) event.getY() ); } } if(event.getAction() == MotionEvent.ACTION_UP) { mSonicAudio.stopLoopedSound(); SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); } return true; } and here's where those methods end up in my sound pool class its horribly messy but that's because I've been trying a ton of variants to get this to work, you will also notice that I begin to hard code the index, again I was trying to get the methods to work before making them work well. package com.mattster.sonicscrewdriver; import java.util.HashMap; import android.content.Context; import android.media.AudioManager; import android.media.SoundPool; public class SoundManager { private float mPowerLvl = 1f; private SoundPool mSoundPool; private HashMap mSoundPoolMap; private AudioManager mAudioManager; private Context mContext; private int streamVolume; private int LoopState; private long mLastTime; public SoundManager() { } public void initSounds(Context theContext) { mContext = theContext; mSoundPool = new SoundPool(2, AudioManager.STREAM_MUSIC, 0); mSoundPoolMap = new HashMap<Integer, Integer>(); mAudioManager = (AudioManager)mContext.getSystemService(Context.AUDIO_SERVICE); streamVolume = mAudioManager.getStreamVolume(AudioManager.STREAM_MUSIC); } public void addSound(int index,int SoundID) { mSoundPoolMap.put(1, mSoundPool.load(mContext, SoundID, 1)); } public void playUpdate(int index) { if( LoopState == 1) { long now = System.currentTimeMillis(); if (now > mLastTime) { mSoundPool.play(mSoundPoolMap.get(1), streamVolume, streamVolume, 1, 0, mPowerLvl); mLastTime = System.currentTimeMillis() + 250; } } } public void stopLoopedSound() { LoopState = 0; mSoundPool.setVolume(mSoundPoolMap.get(1), 0, 0); mSoundPool.stop(mSoundPoolMap.get(1)); } public void startLoopedSound() { LoopState = 1; } public void setPower(int index, float mPower) { mPowerLvl = mPower; mSoundPool.setRate(mSoundPoolMap.get(1), mPowerLvl); } } ah ha! I almost forgot, that looks pretty ineffective but I omitted my thread which actuality updates it, nothing fancy it just calls : mSonicAudio.playUpdate(1); thanks in advance, Matthew

    Read the article

  • Does AS3 show cacheasbitmap in preview?

    - by Fahim Akhter
    The following code shows me that cacheasbitmap is turning on and off like it is suppose to but, I never get to see it visually like I did in AS2. Is this a error or a change in actionscript? package { import flash.display.Sprite; import flash.events.MouseEvent; public class Bitmapascache extends Sprite { private var isOn:Boolean=false; private var box:mainBox; public function Bitmapascache() { box = new mainBox() box.addEventListener(MouseEvent.MOUSE_DOWN,click); this.addChild(box); } public function click(e:MouseEvent):void { trace("click :"+box.cacheAsBitmap); if(isOn){ box.cacheAsBitmap = false; isOn = false; } else{ box.cacheAsBitmap = true; isOn = true; } } } }

    Read the article

< Previous Page | 288 289 290 291 292 293 294 295 296 297 298 299  | Next Page >