Search Results

Search found 28919 results on 1157 pages for 'open with'.

Page 321/1157 | < Previous Page | 317 318 319 320 321 322 323 324 325 326 327 328  | Next Page >

  • Attaching HTML file as email in VB 6.0

    - by Shax
    Hi, I am trying to attach an html file file to email using Visual Basic 6.0. when the cursor is comes on Open strFile For Binary Access Read As #hFile line it gives error "Error encoding file - Bad file name or number". Please all your help and support would be highly appreciated. Dim handleFile As Integer Dim strValue As String Dim lEventCtr As Long handleFile = FreeFile Open strFile For Binary Access Read As #handleFile Do While Not EOF(hFile) ' read & Base 64 encode a line of characters strValue = Input(57, #handleFile) SendCommand EncodeBase64String(strValue) & vbCrLf ' DoEvents (occasionally) lEventCtr = lEventCtr + 1 If lEventCtr Mod 50 = 0 Then DoEvents Loop Close #handleFile Exit Sub File_Error: Close #handleFile m_ErrorDesc = "Error encoding file - " & Err.Description Err.Raise Err.Number, Err.Source, m_ErrorDesc End Sub

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • how to show a html webpage in a GUI in Java

    - by Robert
    Dear all, I've recently worked on a project on search query,and I am only last step away from completion. Now I have a nice URL,and can open it in "cmd /c start" statement in Java,and it causes an IE window open. However,my advisor is not satisfied with that,he wants to see this webpage(actually,two webpages) opened in a GUI interface. So could you please give a detailed instruction on how to achieve this in Java,please?If you are trying to offer me a helpful package,would you please kindly also show how to use that as well,since I am new to this GUI development,and I only know the basics of Swing. Thanks a lot,it is dued within this week.

    Read the article

  • Virtual drivers with Windows Driver Model - where to begin?

    - by waitinforatrain
    I've never written drivers before but I'm starting an open-source project that involves creating virtual MIDI ports that will send the MIDI data over a network. For this, I presume I would be creating some sort of virtual driver using WDM (unless it's possible with kernel hooks?) - but being a beginner to driver development I don't know where to begin. Does anyone know any useful resources that would help me with this project? Or some open-source code from a similar project that I could fork as a starting point?

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Send file by webservice

    - by phenevo
    Hi, I have webservice, wwith method: [WebMethod] public byte[] GetFile(string FName) { System.IO.FileStream fs1 = null; fs1 = System.IO.File.Open(FName, FileMode.Open, FileAccess.Read); byte[] b1 = new byte[fs1.Length]; fs1.Read(b1, 0, (int)fs1.Length); fs1.Close(); return b1; } and it works with small file like 1mb, but when it comes to photoshop's file (about 1,5gb) I get: System.OutOfMemoryException The idea is I have winforms application which get this file and saving it on local disc.

    Read the article

  • Ad/Banner Management/Rotation for Ruby on Rails?

    - by David N. Welton
    Hi, I have a niche site that I'd like to sell banners for directly, rather than going through adsense. I need a system to manage the whole process: displaying ads and an administrative interface to manage them. It doesn't have to be anything terribly fancy, although open source is greatly preferred so that I can grow the system as needs be. Since the site itself is in Rails, I would prefer something for that environment. Googling turns up bunches of them in PHP, but the results are a bit polluted and I didn't have any luck finding one that was done in/for Rails. If I don't find one, I suppose I'll see what I can do to hack together something and release it myself under an open license. Another possibility is this: http://www.google.com/admanager - anyone have anything to say about it? Is it right for someone just selling a few ads for a not-so-big site? Thanks, Dave

    Read the article

  • MQ Connection - 2009 error

    - by user171523
    am connectting the MQ with below code. I am able connected to MQ successfully. My case is i place the messages to MQ every 1 min once. After disconnecting the cable i get a ResonCode error but IsConnected property still show true. Is this is the right way to check if the connection is still connected ? Or there any best pratcices around that. I would like to open the connection when applicaiton is started keep it open for ever. public static MQQueueManager ConnectMQ() { if ((queueManager == null) || (!queueManager.IsConnected)||(queueManager.ReasonCode == 2009)) { queueManager = new MQQueueManager(); } return queueManager; }

    Read the article

  • JQuery UI question, how do you add variables into the dialog box

    $('.openDialog').click(function(event){ var width=$(this).attr('width'); var height=$(this).attr('height'); alert(width + ' ' + height); event.preventDefault(); $("#dialog").dialog({autoOpen: false, modal: true}); $('#dialog').dialog('option', 'width', width); $('#dialog').dialog('open'); $('#dialog p').load('http://pagetoload.com/page.html .content'); }); As you can see above i'm trying to open a dialog box with a passed in parameter of width and height, however when I try and pass in the value of width on this line: $('#dialog').dialog('option', 'width', width); it doesn't work, any ideas why or how to get around that? Thanks

    Read the article

  • browser cookie issue

    - by George2
    Hello everyone, In my previous understanding, for a web site, only login user of a web site (no matter what login/authentication approach is used) could have cookie as persistent identifier, so that if the user close the browser, open browser again to go to the same web site, the web site could remember the user. But I learned recently that it seems for non-login user, there could still be a cookie associated with the user (after the user close browser, and then open the browser again to go to the same web site, the web site could remember the user), and it is called browser cookie? Is that true? If it is true, who is responsible to set the browser cookie? i.e. need some coding/config at web server side, client browser configuration (without coding from server side), or both? How could web server access such cookie? Appreciate if any code samples. thanks in advance, George

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Python - Things I shouldn't be doing?

    - by cornjuliox
    I've got a few questions about best practices in Python. Not too long ago I would do something like this with my code: ... junk_block = "".join(open("foo.txt","rb").read().split()) ... I don't do this anymore because I can see that it makes code harder to read, but would the code run slower if I split the statements up like so: f_obj = open("foo.txt", "rb") f_data = f_obj.read() f_data_list = f_data.split() junk_block = "".join(f_data_list) I also noticed that there's nothing keeping you from doing an 'import' within a function block, is there any reason why I should do that?

    Read the article

  • Android: how to set click events on ListView?

    - by Capsud
    Hey there, I'm looking to be able to open up a new view or activity when I click on an item in my ListView. Currently I have a list of restaurants, and when i click on a particular restaurant I want it to open up another screen that will show its address, google map etc. What I need help with is knowing how to set click events on the items in the list. At the moment I dont have a database of the items, they're just Strings. Can someone help me with getting me to this stage? Thanks alot.

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • post data to a thickbox using ajax

    - by sqlchild
    I need to post data to a thickbox using ajax and open it immediately and display the posted data. The user would click on a link/button and the data i.e. value of the selected checkboxes would be posted to "my_thickbox.php" and the thickbox (url : my_thickbox.php) would open with checkbox values displayed. <div id="showthickbox" ><a href="my_thickbox.php" class="thickbox"></div> $('#showthickbox').click(function() { var data = $('input:checkbox:checked').map(function() { return this.value; }).get(); $.ajax({ type: 'POST', url: 'my_thickbox.php', data: data, success: success, dataType: dataType }); });

    Read the article

  • C++ iostream not setting eof bit even if gcount returns 0

    - by raph.amiard
    Hi I'm developping an application under windows, and i'm using fstreams to read and write to the file. I'm writing with fstream opened like this : fs.open(this->filename.c_str(), std::ios::in|std::ios::out|std::ios::binary); and writing with this command fs.write(reinterpret_cast<char*>(&e.element), sizeof(T)); closing the file after each write with fs.close() Reading with ifstream opened like this : is.open(filename, std::ios::in); and reading with this command : is.read(reinterpret_cast<char*>(&e.element), sizeof(T)); The write is going fine. However, i read in a loop this way : while(!is.eof()) { is.read(reinterpret_cast<char*>(&e.element), sizeof(T)); } and the program keeps reading, even though the end of file should be reached. istellg pos is 0, and gcount is equal to 0 too, but the fail bit and eof bit are both ok. I'm running crazy over this, need some help ...

    Read the article

  • Panel widget overlapping other contents in android

    - by walker
    I'm trying to utilize the Panel widget introduced in android-misc-widgets. It's been good so far. Now the problem is the sliding panel overlaps my top menu bar. For clarification look at the following screenshots. This is when I open panel using drag gesture (no problem here): This is when I open the panel with a single tap (look at the icons overlapping the top menu): There is one other problem, If there is any content inside the activity, opening the panel pushes that content out of the screen!

    Read the article

  • Loading url with cyrillic symbols

    - by Ockonal
    Hi guys, I have to load some url with cyrillic symbols. My script should work with this: http://wincode.org/%D0%BF%D1%80%D0%BE%D0%B3%D1%80%D0%B0%D0%BC%D0%BC%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5/ If I'll use this in browser it would replaced into normal symbols, but urllib code fails with 404 error. How to decode correctly this url? When I'm using that url directly in code, like address = 'that address', it works perfect. But I used parsing page for getting this url. I have a list of urls which contents cyrillic. Maybe they have uncorrect encoding? Here is more code: requestData = urllib2.Request( %SOME_ADDRESS%, None, {"User-Agent": user_agent}) requestHandler = pageHandler.open(requestData) pageData = requestHandler.read().decode('utf-8') soupHandler = BeautifulSoup(pageData) topicLinks = [] for postBlock in soupHandler.findAll('a', href=re.compile('%SOME_REGEXP%')): topicLinks.append(postBlock['href']) postAddress = choice(topicLinks) postRequestData = urllib2.Request(postAddress, None, {"User-Agent": user_agent}) postHandler = pageHandler.open(postRequestData) postData = postHandler.read() File "/usr/lib/python2.6/urllib2.py", line 518, in http_error_default raise HTTPError(req.get_full_url(), code, msg, hdrs, fp) urllib2.HTTPError: HTTP Error 404: Not Found

    Read the article

  • Set a script to automatically detect character encoding in a plain-text-file in Python?

    - by Haidon
    I've set up a script that basically does a large-scale find-and-replace on a plain text document. At the moment it works fine with ASCII, UTF-8, and UTF-16 (and possibly others, but I've only tested these three) encoded documents so long as the encoding is specified inside the script (the example code below specifies UTF-16). Is there a way to make the script automatically detect which of these character encodings is being used in the input file and automatically set the character encoding of the output file the same as the encoding used on the input file? findreplace = [ ('term1', 'term2'), ] inF = open(infile,'rb') s=unicode(inF.read(),'utf-16') inF.close() for couple in findreplace: outtext=s.replace(couple[0],couple[1]) s=outtext outF = open(outFile,'wb') outF.write(outtext.encode('utf-16')) outF.close() Thanks!

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

< Previous Page | 317 318 319 320 321 322 323 324 325 326 327 328  | Next Page >