Search Results

Search found 38817 results on 1553 pages for 'inline function'.

Page 329/1553 | < Previous Page | 325 326 327 328 329 330 331 332 333 334 335 336  | Next Page >

  • JQuery Help: toggle() is not working properly

    - by John Smith
    Hi All, I'm trying to use JQuery toggle functionality, but not able to use properly. Instead of smooth slide up and down, it goes very fast and not in an animated manner. I want to achieve sliding effect in my code, like this has (Please see Website Design, Redesign Services slider): Here is my code: HTML: <div> <div class="jquery_inner_mid"> <div class="main_heading"> <a href="#"> <img src="features.jpg" alt="" title="" border="0" /></a> </div> <div class="plus_sign"> <img id="imgFeaturesEx" src="images/plus.jpg" alt="" title="" border="0" /> <img id="imgFeaturesCol" src="images/minus.jpg" alt="" title="" border="0" /></div> <div class="toggle_container"> <div id="divMain" > </div> </div> </div> <div class="jquery_inner_mid"> <div class="main_heading"> <img src="About.jpg" alt="" title="" /></div> <div class="plus_sign"> <img id="imgTechnoEx" src="images/plus.jpg" alt="" title="" border="0" /> <img id="imgTechnoCol" src="images/minus.jpg" alt="" title="" border="0" /></div> <div class="toggle_container"> <div id="divTechnossus" > </div> </div> </div> </div> JQuery: $(function() { document.getElementById('imgFeaturesCol').style.display = 'none'; document.getElementById('imgTechnoCol').style.display = 'none'; $('#imgFeaturesEx').click(function() { $.getJSON("/Visitor/GetFeatureInfo", null, function(strInfo) { document.getElementById('divMain').innerHTML = strInfo; }); $("#divMain").toggle("slow"); document.getElementById('imgFeaturesEx').style.display = 'none'; document.getElementById('imgFeaturesCol').style.display = 'block'; }); $('#imgFeaturesCol').click(function() { document.getElementById('divMain').innerHTML = ""; $("#divMain").toggle("slow"); document.getElementById('imgFeaturesCol').style.display = 'none'; document.getElementById('imgFeaturesEx').style.display = 'block'; }); $('#imgTechnoEx').click(function() { $.getJSON("/Visitor/GetTechnossusInfo", null, function(strInfo) { document.getElementById('divTechnossus').innerHTML = strInfo; }); $("#divTechnossus").slideToggle("slow"); document.getElementById('imgTechnoEx').style.display = 'none'; document.getElementById('imgTechnoCol').style.display = 'block'; }); $('#imgTechnoCol').click(function() { document.getElementById('divTechnossus').innerHTML = ""; $("#divTechnossus").slideToggle("slow"); document.getElementById('imgTechnoCol').style.display = 'none'; document.getElementById('imgTechnoEx').style.display = 'block'; }); });

    Read the article

  • PHP IP Validation Help

    - by Zubair1
    Hello, I am using this IP Validation Function that i came across while browsing, it has been working well until today i ran into a problem. For some reason the function won't validate this IP as valid: 203.81.192.26 I'm not too great with regular expressions, so would appreciate any help on what could be wrong. If you have another function, i would appreciate if you could post that for me. |--------------------------------------------| The code for the function is below: |--------------------------------------------| public static function validateIpAddress($ip_addr) { global $errors; $preg = '#^(?:(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)\.){3}' . '(?:25[0-5]|2[0-4][0-9]|[01]?[0-9][0-9]?)$#'; if(preg_match($preg, $ip_addr)) { //now all the intger values are separated $parts = explode(".", $ip_addr); //now we need to check each part can range from 0-255 foreach($parts as $ip_parts) { if(intval($ip_parts) > 255 || intval($ip_parts) < 0) { $errors[] = "ip address is not valid."; return false; } return true; } return true; } else { $errors[] = "please double check the ip address."; return false; } }

    Read the article

  • jQuery ajaxForm "h is undefined" problem

    - by Simon
    I have a form that is brought up in a ajaxed modal which I am using for updating user details. When the modal loads I call a js function: teamCreate: function() { $j("#step1,form#createEditTeam").show(); $j("#step2").hide(); var options = { type: "get", dataType: 'json', beforeSubmit: before, // pre-submit callback success: success // post-submit callback }; $j("form#createEditTeam").ajaxForm(options); function before(formData, jqForm, options){ var valid = $j("form#createEditTeam").valid(); if (valid === true) { $j(".blockMsg").block({ message: $j('#panelLoader') }); return true; // submit the form } else { $j("form#createEditTeam").validate(); return false; // prevent form from submitting } }; function success(data){ if (data.status == "success") { $j(".blockMsg").unblock(); } else { // } }; function error(xhr, ajaxOptions, thrownError){ alert("Error code: " + xhr.statusText); }; } This works just fine when I first submit the form, regardless how many times the modal is opened and closed. However, if I submit the form and then open the modal again and try to submit the form again I get a js error: h is undefined

    Read the article

  • Why wont this JS code work if its all on the same line?

    - by culov
    I'm writing HTML code for a java servlet. i first write the code in html/js so i can debug what im working on, and then ill make it a java string and put it in my servlet. My problem is that the code is working fine when i view it in ff from a local html file, but when i view it on my java servlet, it doesnt work because the js isnt getting called. what I did was format the html that my servlet generated so that its not all on a single line and ran the code again. This time it worked. I copied this working code into a browser address bar so that it will all be on a single line, and copied that code back into the script in my html file. Now, when the previously working code is on a single line, it doesnt work. Here's the formatted JS: var sMax var holder; var preSet; var rated; var request; function rating(num){ sMax = 0; for(n=0; n<num.parentNode.childNodes.length; n++){ if(num.parentNode.childNodes[n].nodeName == "A"){ sMax++; } } if(!rated){ s = num.id.replace("_", ''); a = 0; for(i=1; i<=sMax; i++){ if(i<=s){ document.getElementById("_"+i).className = "on"; document.getElementById("rateStatus").innerHTML = num.title; holder = a+1; a++; }else{ document.getElementById("_"+i).className = ""; } } } } function off(me){ if(!rated){ if(!preSet){ for(i=1; i<=sMax; i++){ document.getElementById("_"+i).className = ""; document.getElementById("rateStatus").innerHTML = me.parentNode.title; } }else{ rating(preSet); document.getElementById("rateStatus").innerHTML = document.getElementById("ratingSaved").innerHTML; } } } function rateIt(me){ if(!rated){ document.getElementById("rateStatus").innerHTML = document.getElementById("ratingSaved").innerHTML + " "+me.title; preSet = me; rated=1; sendRate(me); rating(me); } } function sendRate(sel){ alert("Your rating was: "+sel.title); addRating("rating", "?truck=kogibbq?rating="+ sel.id); } function addRating(servletName, servletArguments){ var servlet = servletName; var arg = servletArguments var req = servlet + arg; alert(req); addrequest(req); request.onreadystatechange = function(){ alert("response received"); } } function addrequest(req) { try { request = new XMLHttpRequest(); }catch (e) { try { request = new ActiveXObject("Microsoft.XMLHTTP"); }catch (e) { alert("XMLHttpRequest error: " + e); } } request.open("GET", element, true); request.send(null); return request; } Thanks.

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • JQuery animate div "like" a Zoom

    - by Russell Parrott
    I can never get these to work - sorry - but I I am trying to animate on a mouse over then "re-animate" on a mouse out. I can never get $('#xyz').hover(function(){'something',function(){'somethingelse'}); to work. Hope you guys can help. What I am trying to do is animate + and - 20px (top and left) on some absolutely positioned divs and then add 40px to the width height returning to the original position/width/height on mouse out. I haven't even got to the css widths/heights yet .... Here is my code (which is wrong - well it must be as it doesn't work :-) ) $('.box').hover(function(){ $(this).animate({'top':'-20','left':'-20'},function(){ $(this).animate({'top':'20','left':'20' }); }); Help really appreciated. Thanks in advance

    Read the article

  • Click event on submit buttons only fires once

    - by Chris
    I subscribe to the click event on all submit buttons on my page once loaded. All buttons fire off the correct event when clicked, but this only works once. If you click any two buttons in a row the second button submits the form normally as opposed to running the script. What am I doing wrong?. Note: I load the form data from "myurl" using .load() then hook up to the submit buttons' click events in the complete event. $(document).ready(function() { //Load user content $("#passcontent").load("myurl", function() { //subscribe to click events for buttons to post the data back $('input[type=submit]').click(function() { return submitClick($(this)); }); }); }); function submitClick(submitButton) { submitButton.attr("disabled", true); alert(submitButton.closest("form").serialize()); $.post("myurl", submitButton.closest("form").serialize(), function(data) { alert("woop"); $("#passcontent").html(data); }); //Prevent normal form submission process from continuing return false; }

    Read the article

  • which is the most secure way to check variables type javascript

    - by mck89
    Hi, i need to check the type of a variable in javascript, i know 3 ways to do it: instanceof operator: if(a instanceof Function) typeof operator: if(typeof a=="function" toString method (jQuery uses this): Object.prototype.toString.call(a) == "[object Function]" Which is the most secure way to do type checking beetween these solutions? and why? Please don't tell me that the last solution is better only because jQuery uses that.

    Read the article

  • JQuery never reaches success or fail on aspx returning json.

    - by David
    Basicaly I have my aspx page doing <% Response.Clear(); Response.Write("{\"Success\": \"true\" }"); Response.End(); %> My JQuery code is function DoSubmit(r) { if (r == null || r.length == 0 || formdata == null || formdata.length == 0) return; for (i = 0; i < formdata.length; i++) { var fd = formdata[i]; r[fd.Name] = fd.Value; } r["ModSeq"] = tblDef.ModSeq; jQuery.ajax({ url: "NashcoUpdate.aspx" , succsess: doRow , error: DoSubmitError , complete: DoSubmitComplete , dataType: "json" , cache: false , data: r , type: "post" }) } When I call the DoSubmit() function every thing works but the doRow or DoSubmitError functions never get called only the DoSubmitComplete function. When I look at the response text in teh DoSubmitComple function it is {"Success": "true" } Every JSON tester I have tried says that this is valied JSON. What am I doing wrong here?

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • jqModal and jquery widget long shot

    - by rod
    Hi All, I just started playing around with jquery widgets within my jqmodals in my mvc app. I know this may be a long shot but I'll take it. Initially, I can click the Add link, get the alert ("which is the prize", watching too much tv), next click cancel to close modal and get the desired results. I can, then, click the Edit link and get the same desired results. However, if I click Edit link first then I try to click the Add link, "forget about it" I don't get the alert (which means my widget did not init). But I can still go back and click Edit and get the prize (the alert message). ajax: "/Home/EditPrintAdLine" and ajax: "/Home/AddPrintAdLine" render the same web user control Any ideas? <%@ Page Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage" %> <asp:Content ID="indexTitle" ContentPlaceHolderID="TitleContent" runat="server"> Home Page </asp:Content> <asp:Content ID="indexContent" ContentPlaceHolderID="MainContent" runat="server"> <h2><%= Html.Encode(ViewData["Message"]) %></h2> <p> To learn more about ASP.NET MVC visit <a href="http://asp.net/mvc" title="ASP.NET MVC Website">http://asp.net/mvc</a>. </p> <div id="printAdLineEditDialog" class="jqmWindow"></div> <div id="printAdDialog" class="jqmWindow"></div> <table> <tr><td><a id="printAdLineItem" href="#">Add a Line Item</a></td></tr> <tr><td><a id="editPrintAdLine" href="#">Edit</a></td></tr> </table> <script type="text/javascript"> $(document).ready(function() { $.widget("ui.my_widget", { _init: function() { alert("My widget was instantiated"); } }); // Add line $('#printAdLineItem').click(function(e) { $('#printAdDialog').jqmShow(this); e.preventDefault(); }); $('#printAdDialog').jqm({ ajax: "/Home/AddPrintAdLine", onLoad: function(hash) { $('#PrintAdLine_RunDate').my_widget(); } }); // Edit line $('#editPrintAdLine').click(function(e) { $('#printAdLineEditDialog').jqmShow(this); e.preventDefault(); }); $('#printAdLineEditDialog').jqm({ ajax: "/Home/EditPrintAdLine", onLoad: function(hash) { $('#PrintAdLine_RunDate').my_widget(); } }); }); </script> </asp:Content>

    Read the article

  • Implementing password hashing/salting algorithm from crackstation.net

    - by Mason240
    I am trying to implement a password hashing/salting algorithm from crackstation.net, but I am unsure how implement it. Storing the password upon user registration seems to be as simple as passing the password into create_hash(). $password = create_hash($_POST['Password']; I'm not following how to validate upon user login. validate_password($password, $good_hash) returns either true or false, and takes $password as parameter, so it seems like a no brainer except for the second parameter $good_hash. Where does this param come from? It is my understanding that password is turned into a hash value every time its used, and that the hash value is what is stored and compared. So why would I have both the $password and $good_hash values? Quick overview of the functions: function create_hash($password){ calls pbkdf2() } function validate_password($password, $good_hash){ calls pbkdf2() calls slow_equals() } function slow_equals($a, $b){ } function pbkdf2($algorithm, $password, $salt, $count, $key_length, $raw_output = false){ } Of course a different, better method for this would also be just as helpful. Thank you

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • I have a filter for jquery masonry - but I want to filter moomasonry

    - by Jason
    Hi, I'm using jquery masonry for layout. But I am considering moving to mootools. I have found a masonry port to mootools, called moomasonry - http://www.crionics.com/products/opensource/mooMasonry/Demos/basic.html With help here, I have a filter on the masonry divs by class: $('a.filter').click(function(){ filterBoxes(this.id); }) function filterBoxes(klass){ if (klass == "all") { klass = "box" } $('#holder').find('.' + klass) .hide() .appendTo('#main') .fadeIn('200') $('#main').find('.box:not(.' + klass + ')') .fadeOut( '200', function(){ $(this).appendTo('#holder') ; }); setTimeout(function(){ $('#main').masonry() },500); } But, how would I filter divs by class in mootools? and have it reload masonry after each filter. See my site for example: http://jasondaydesign.com/masonry_demo/

    Read the article

  • trying to fade out a top div on hover to reveal working links in text below using JQuery

    - by Heath
    I need to fade a div (and image) to reveal a div underneath (text with clickable links) using jQuery. <script> $(document).ready(function(){ $("img.a").hover( function() { $(this).stop().animate({"opacity": "0"}, "slow"); }, function() { $(this).stop().animate({"opacity": "1"}, "slow"); }); }); </script> Used the above code and all worked well, until I went to click the links. Seems the top hidden div is preventing me from doing so. Tried the replaceWith function and that allowed me to click the links too - but couldn't get it to go back to showing original div when I moused out. Also, bossman wants the transition to be gradual - like a fade... Any suggestions? Many thanks! Heath

    Read the article

  • JavaScript on jQuery created code never gets called

    - by mare
    This is my view in ASP.NET MVC. <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Administration.Master" Inherits="System.Web.Mvc.ViewPage" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="HeadContent" runat="server"> <script type="text/javascript"> var ddlContentTypes; $(document).ready(function () { ddlContentTypes = $("#ContentTypes"); ddlContentTypes.bind("change", loadCreate); loadCreate(); }); function loadCreate() { var typeId = $("#ContentTypes option:selected").val(); $.get('~/' + typeId + '/Create', function (data) { $("#CreateForm").html(data); }); $("fieldset input").each(function (index, item) { $(item).attr("disabled", true); }); } </script> </asp:Content> <asp:Content ID="Content3" ContentPlaceHolderID="MainContent" runat="server"> <h2> <%=Resources.Localize.CreateWidget %></h2> <p> <% Html.RenderPartial("ContentTypeSelector"); %></p> <div id="CreateForm"> </div> </asp:Content> As you can see, it loads some HTML (actually user control) and adds it to the CreateForm div. This actually works fine. The problem is this $("fieldset input").each(function (index, item) { $(item).attr("disabled", true); }); never runs. The fieldset tag is in the response, so you don't see it here but it's there - everything is returned back fine (I checked with Firebug). Why do the above two lines of JS never run or have any effect?

    Read the article

  • Ruby on Rails: jQuery datepicker - dates between validation

    - by Jazz
    I have an app that allows a user to create new projects, and the search for them later. One of the options they have when creating a project is giving them start and end dates. At the moment all the code works properly for creating and searching on the dates, but I am now wanting to restrict what dates the user can enter. I am needing for an error to flag up when the user tries to enter an end date that is before the start date. It's really more for when the user is creating the project. Here is my code so far = Application.js //= require jquery //= require jquery_ujs //= require jquery-ui //= require jquery.ui.all //= require_tree . $(function() { $("#project_start_date").datepicker({dateFormat: 'dd-mm-yy'}); }); $(function() { $("#project_end_date").datepicker({dateFormat: 'dd-mm-yy'}); }); jQuery(function(){ jQuery('#start_date_A').datepicker({dateFormat: "dd-mm-yy"}); }); jQuery(function(){ jQuery('#start_date_B').datepicker({dateFormat: "dd-mm-yy"}); }); New View: <div class="start_date" STYLE="text-align: left;"> <b>Start Date:</b> <%= f.text_field :start_date, :class => 'datepicker', :style => 'width: 80px;' %> </div> <div class="end_date" STYLE="text-align: left;"> <b>End Date:</b> <%= f.text_field :end_date, :class => 'datepicker', :style => 'width: 80px;' %> </div> Search View: Start dates between <%= text_field_tag :start_date_A, params[:start_date_A], :style => 'width: 80px;' %> - <%= text_field_tag :start_date_B, params[:start_date_B], :style => 'width: 80px;' %></br> I tried following examples online to get this to work by doing this in the application.js file: $(function() { $("#project_start_date,#project_end_date").datepicker({dateFormat: 'dd-mm-yy'}); }); jQuery(function(){ jQuery('#start_date_A,#start_date_B').datepicker({dateFormat: "dd-mm-yy"}); }); But then the script doesn't run. I am new to rails and javascript so any help at all is appreciated. Thanks in advance. UPDATE: Don't know why my question has been voted to be closed. It's quite simple: I need an error to flag up when the user tries to enter an end date that is before the start date. How can I do that??

    Read the article

  • ajax response redirect problem

    - by zurna
    When my member registration form correctly filled in and submitted, server responds with redirect link. But my ajax does not redirect the website. I do not receive any errors, where is my mistake? <script type="text/javascript"> $(document).ready(function() { $("[name='submit']").click(function() { $.ajax({ type: "POST", data: $(".form-signup").serialize(), url: "http://www.refinethetaste.com/FLPM/content/myaccount/signup.cs.asp?Process=Add2Member", success: function(output) { if (output.Redirect) { window.location.href = output.Redirect; } else { $('.sysMsg').html(output); } }, error: function(output) { $('.sysMsg').html(output); } }); }); }); </script> asp codes: If Session("LastVisitedURL") <> "" Then Response.Redirect Session("LastVisitedURL") Else Response.Redirect "?Section=myaccount&SubSection=myaccount" End If

    Read the article

  • Modify jkpanel to load internal content instead of external content

    - by Adam Stone
    I am using an implementation of jkpanel in a vb.net app, the script (see below) loads an external file into the drop down panel. I need to modify this script to load an internal content like a specific div or span so that I can have this nested within the master page. //Drop Down Panel script (March 29th, 08'): By JavaScript Kit: http://www.javascriptkit.com var jkpanel={ controltext: 'Panel Content', $mainpanel: null, contentdivheight: 0, openclose:function($, speed){ this.$mainpanel.stop() //stop any animation if (this.$mainpanel.attr('openstate')=='closed') this.$mainpanel.animate({top: 0}, speed).attr({openstate: 'open'}) else this.$mainpanel.animate({top: -this.contentdivheight+'px'}, speed).attr({openstate: 'closed'}) }, init:function(file, height, speed){ jQuery(document).ready(function($){ jkpanel.$mainpanel=$('<div id="dropdownpanel"><div class="contentdiv"></div><div class="control">'+jkpanel.controltext+'</div></div>').prependTo('body') var $contentdiv=jkpanel.$mainpanel.find('.contentdiv') var $controldiv=jkpanel.$mainpanel.find('.control').css({cursor: 'wait'}) $contentdiv.load(file, '', function($){ var heightattr=isNaN(parseInt(height))? 'auto' : parseInt(height)+'px' $contentdiv.css({height: heightattr}) jkpanel.contentdivheight=parseInt($contentdiv.get(0).offsetHeight) jkpanel.$mainpanel.css({top:-jkpanel.contentdivheight+'px', visibility:'visible'}).attr('openstate', 'closed') $controldiv.css({cursor:'hand', cursor:'pointer'}) }) jkpanel.$mainpanel.click(function(){jkpanel.openclose($, speed)}) }) } } //Initialize script: jkpanel.init('path_to_content_file', 'height of content DIV in px', animation_duration) jkpanel.init('panelcontent.htm', '200px', 500) Does anybody have any idea on how to modify this to do so or even have any tips or pointers to point me in the right direction to start doing so. Cheers

    Read the article

  • Defaults for null values

    - by OldFart
    Working on a Powershell script I had several places where I wanted A unless it was null, else B. Essentially the ?? operator in C#. I ended up writing the function shown below, but I can't help but think there is a built-in way to do this. Is there a better, built-in, way? function Get-ValueOrDefault() { foreach ($value in $args) { if ($value -ne $null) { return $value } } } I think this works better: function Get-ValueOrDefault() { $args | select -first 1 }

    Read the article

  • Using ember-resource with couchdb - how can i save my documents?

    - by Thomas Herrmann
    I am implementing an application using ember.js and couchdb. I choose ember-resource as database access layer because it nicely supports nested JSON documents. Since couchdb uses the attribute _rev for optimistic locking in every document, this attribute has to be updated in my application after saving the data to the couchdb. My idea to implement this is to reload the data right after saving to the database and get the new _rev back with the rest of the document. Here is my code for this: // Since we use CouchDB, we have to make sure that we invalidate and re-fetch // every document right after saving it. CouchDB uses an optimistic locking // scheme based on the attribute "_rev" in the documents, so we reload it in // order to have the correct _rev value. didSave: function() { this._super.apply(this, arguments); this.forceReload(); }, // reload resource after save is done, expire to make reload really do something forceReload: function() { this.expire(); // Everything OK up to this location Ember.run.next(this, function() { this.fetch() // Sub-Document is reset here, and *not* refetched! .fail(function(error) { App.displayError(error); }) .done(function() { App.log("App.Resource.forceReload fetch done, got revision " + self.get('_rev')); }); }); } This works for most cases, but if i have a nested model, the sub-model is replaced with the old version of the data just before the fetch is executed! Interestingly enough, the correct (updated) data is stored in the database and the wrong (old) data is in the memory model after the fetch, although the _rev attribut is correct (as well as all attributes of the main object). Here is a part of my object definition: App.TaskDefinition = App.Resource.define({ url: App.dbPrefix + 'courseware', schema: { id: String, _rev: String, type: String, name: String, comment: String, task: { type: 'App.Task', nested: true } } }); App.Task = App.Resource.define({ schema: { id: String, title: String, description: String, startImmediate: Boolean, holdOnComment: Boolean, ..... // other attributes and sub-objects } }); Any ideas where the problem might be? Thank's a lot for any suggestion! Kind regards, Thomas

    Read the article

  • jQuery Ajax returns the whole page

    - by Sophia Gavish
    Dear all, I have a jquery-ajax function that sends data to a php script and the problem is with the return value, it returns the whole page instead of single value. Thank you for your time and help. $("#ajaxBtn").click(function(){ var inputText = $("#testText").val(); $.ajax({ type: "POST", url: "index.php", data: "testAjax="+inputText, dataType: "html", success: function(html){ alert(html); } }); });

    Read the article

  • Unique JQuery Events for a Class

    - by Daniel Macias
    I am trying to create a class that can send a unique jQuery event. Example: function Bomb(id) { this.evnt = $.Event("BOOM!_" + id); this.detonate = function() { $(document).trigger(evnt); }; } var firecracker = new Bomb(); var nuclearbomb = new Bomb(); $(document).bind(firecracker.evnt.type, function(){ // It's the fourth of july!!! }); $(document).bind(nuclearbomb.evnt.type, function(){ // We're dead }); firecracker.detonate(); nuclearbomb.detonate(); How can I create a unique event within the Bomb class without having to pass in an ID to create a unique event string for the class?

    Read the article

  • Jquery .val() for input only works once.

    - by Bolt_Head
    I'm trying to create a chat box for my game. The user type's their chat into the input:text feild and by ither pressing Enter or clicking the button submits the chat text. This all works, however for some reason after the first time a user submits a chat message it fails to get the text from the input field. Here is my code. $(document).ready(function() { $("#chatEnter").live('click',function(){ var chat = $('#chatText').val(); sendChat(chat); }); }); $(document).ready(function() { $("#chatText").keypress(function(e){ if ((e.which && e.which == 13) || (e.keyCode && e.keyCode == 13)) { var chat = $('#chatText').val(); sendChat(chat); return false; } else return true; }); }); function sendChat(chat) { alert(chat); //temp test alert $.getJSON("includes/boardUpdate.php",{chat: chat, bid: bid}); $('#chatText').val(""); } It doesn't matter if i first submit a text by clicking the button or pressing enter, all future attempts submit blank entrys until I refresh the page. Edit: I've tried it with and without the line to clear the text box, same results both ways. Your help is appreciated.

    Read the article

< Previous Page | 325 326 327 328 329 330 331 332 333 334 335 336  | Next Page >