Search Results

Search found 38817 results on 1553 pages for 'inline function'.

Page 329/1553 | < Previous Page | 325 326 327 328 329 330 331 332 333 334 335 336  | Next Page >

  • How to properly read 16 byte unsigned integer with BinaryReader

    - by Brent
    I need to parse a binary stream in .NET to convert a 16 byte unsigned integer. I would like to use the BinaryReader.ReadUIntXX() functions but there isn't a BinaryReader.ReadUInt128() function available. I assume I will have to roll my own function using the ReadByte function and build an array but I don't know if this is the most efficient method? Thanks!

    Read the article

  • .NET Programmatically invoke screenclick doesn't work?

    - by ropstah
    I'm trying to programmatically invoke an onclick event however the click is not received/handled. Am I missing something, or is security preventing the click to be executed? I have a forms application which is invisible. Basically I would like to say: DoDoubleClick(wait, x, y) This should raise two click (mousedown+mouseup) events on screen with the specified wait interval. However the click isn't received in a Flash application in Firefox (which is running at that moment). Here's my code: Form: Public Class Form1 Private WithEvents gmh As GlobalMouseHook Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load gmh = New GlobalMouseHook() Me.Visible = false gmh.DoDoubleClick(50, 800, 600) End Sub Private Sub Form1_FormClosed(ByVal sender As System.Object, ByVal e As System.Windows.Forms.FormClosedEventArgs) Handles MyBase.FormClosed gmh.Dispose() End Sub Private Sub gmh_MouseDown(ByVal sender As Object, ByVal e As System.Windows.Forms.MouseEventArgs) Handles gmh.MouseDown End Sub Private Sub gmh_MouseMove(ByVal sender As Object, ByVal e As System.Windows.Forms.MouseEventArgs) Handles gmh.MouseMove End Sub Private Sub gmh_MouseUp(ByVal sender As Object, ByVal e As System.Windows.Forms.MouseEventArgs) Handles gmh.MouseUp End Sub End Class GlobalMouseHook class: Friend Class GlobalMouseHook Implements IDisposable Private hhk As IntPtr = IntPtr.Zero Private disposedValue As Boolean = False Public Event MouseDown As MouseEventHandler Public Event MouseUp As MouseEventHandler Public Event MouseMove As MouseEventHandler Public Sub New() Hook() End Sub Private Sub Hook() Dim hInstance As IntPtr = LoadLibrary("User32") hhk = SetWindowsHookEx(WH_MOUSE_LL, AddressOf Me.HookProc, hInstance, 0) End Sub Private Sub Unhook() UnhookWindowsHookEx(hhk) End Sub Public Sub DoDoubleClick(ByVal wait As Integer, ByVal x As Integer, ByVal y As Integer) RaiseEvent MouseDown(Me, New MouseEventArgs(MouseButtons.Left, 1, x, y, 0)) RaiseEvent MouseUp(Me, Nothing) System.Threading.Thread.Sleep(wait) RaiseEvent MouseDown(Me, New MouseEventArgs(MouseButtons.Left, 1, x, y, 0)) RaiseEvent MouseUp(Me, Nothing) End Sub Private Function HookProc(ByVal nCode As Integer, ByVal wParam As UInteger, ByRef lParam As MSLLHOOKSTRUCT) As Integer If nCode >= 0 Then Select Case wParam Case WM_LBUTTONDOWN RaiseEvent MouseDown(Me, New MouseEventArgs(MouseButtons.Left, 0, lParam.pt.x, lParam.pt.y, 0)) Case WM_RBUTTONDOWN RaiseEvent MouseDown(Me, New MouseEventArgs(MouseButtons.Right, 0, lParam.pt.x, lParam.pt.y, 0)) Case WM_MBUTTONDOWN RaiseEvent MouseDown(Me, New MouseEventArgs(MouseButtons.Middle, 0, lParam.pt.x, lParam.pt.y, 0)) Case WM_LBUTTONUP, WM_RBUTTONUP, WM_MBUTTONUP RaiseEvent MouseUp(Nothing, Nothing) Case WM_MOUSEMOVE RaiseEvent MouseMove(Nothing, Nothing) Case WM_MOUSEWHEEL, WM_MOUSEHWHEEL Case Else Console.WriteLine(wParam) End Select End If Return CallNextHookEx(hhk, nCode, wParam, lParam) End Function Private Structure API_POINT Public x As Integer Public y As Integer End Structure Private Structure MSLLHOOKSTRUCT Public pt As API_POINT Public mouseData As UInteger Public flags As UInteger Public time As UInteger Public dwExtraInfo As IntPtr End Structure Private Const WM_MOUSEWHEEL As UInteger = &H20A Private Const WM_MOUSEHWHEEL As UInteger = &H20E Private Const WM_MOUSEMOVE As UInteger = &H200 Private Const WM_LBUTTONDOWN As UInteger = &H201 Private Const WM_LBUTTONUP As UInteger = &H202 Private Const WM_MBUTTONDOWN As UInteger = &H207 Private Const WM_MBUTTONUP As UInteger = &H208 Private Const WM_RBUTTONDOWN As UInteger = &H204 Private Const WM_RBUTTONUP As UInteger = &H205 Private Const WH_MOUSE_LL As Integer = 14 Private Delegate Function LowLevelMouseHookProc(ByVal nCode As Integer, ByVal wParam As UInteger, ByRef lParam As MSLLHOOKSTRUCT) As Integer Private Declare Auto Function LoadLibrary Lib "kernel32" (ByVal lpFileName As String) As IntPtr Private Declare Auto Function SetWindowsHookEx Lib "user32.dll" (ByVal idHook As Integer, ByVal lpfn As LowLevelMouseHookProc, ByVal hInstance As IntPtr, ByVal dwThreadId As UInteger) As IntPtr Private Declare Function CallNextHookEx Lib "user32" (ByVal hhk As IntPtr, ByVal nCode As Integer, ByVal wParam As UInteger, ByRef lParam As MSLLHOOKSTRUCT) As Integer Private Declare Function UnhookWindowsHookEx Lib "user32" (ByVal hhk As IntPtr) As Boolean ' IDisposable Protected Overridable Sub Dispose(ByVal disposing As Boolean) If Not Me.disposedValue Then If disposing Then ' TODO: free other state (managed objects). End If Unhook() End If Me.disposedValue = True End Sub ' This code added by Visual Basic to correctly implement the disposablepattern. Public Sub Dispose() Implements IDisposable.Dispose ' Do not change this code. Put cleanup code in Dispose(ByValdisposing As Boolean) above. Dispose(True) GC.SuppressFinalize(Me) End Sub End Class

    Read the article

  • Can't print elements in a DIV tag

    - by Mckenzi
    I am using a Drag-able and re-sizeable DIV's in this HTML file. Where the user will place the DIV tag to his desired place in a main parent DIV tag. Now I want to print this main DIV tag, but the problem is that the code which I'm using to PRINT this main DIV is printing in a sequence, like not the way user has arranged the DIV's. Also it doesn't take up the main DIV background IMAGE. here is the code. JAVASCRIPT & CSS <link rel="stylesheet" type="text/css" href="byrei-dyndiv_0.5.css"> <script type="text/javascript" src="http://jqueryjs.googlecode.com/files/jquery-1.3.1.min.js" > </script> <script type="text/javascript" src="byrei-dyndiv_1.0rc1.js"></script> <script language="javascript" type="text/javascript"> function change(boxid,divtoaffect) { content = document.getElementById("" + boxid + "").value.replace(/\n/g, '<br>'); document.getElementById(divtoaffect).innerHTML = content; } function select1() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Sunset.jpg')"; } function select2() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Blue hills.jpg')"; } function PrintElem(elem) { Popup($(elem).text()); } function Popup(data) { var mywindow = window.open('', 'my div', 'height=400,width=600'); mywindow.document.write('<html><head><title>my div</title>'); /*optional stylesheet*/ //mywindow.document.write('<link rel="stylesheet" href="main.css" type="text/css" />'); mywindow.document.write('</head><body >'); mywindow.document.write(data); mywindow.document.write('</body></html>'); mywindow.document.close(); mywindow.print(); return true; } // Print DIV function printContent(id){ str=document.getElementById(id).innerHTML newwin=window.open('','printwin','left=100,top=100,width=400,height=400') newwin.document.write('<HTML>\n<HEAD>\n') newwin.document.write('<TITLE>Print Page</TITLE>\n') newwin.document.write('<script>\n') newwin.document.write('function chkstate(){\n') newwin.document.write('if(document.readyState=="complete"){\n') newwin.document.write('window.close()\n') newwin.document.write('}\n') newwin.document.write('else{\n') newwin.document.write('setTimeout("chkstate()",2000)\n') newwin.document.write('}\n') newwin.document.write('}\n') newwin.document.write('function print_win(){\n') newwin.document.write('window.print();\n') newwin.document.write('chkstate();\n') newwin.document.write('}\n') newwin.document.write('<\/script>\n') newwin.document.write('</HEAD>\n') newwin.document.write('<BODY onload="print_win()">\n') newwin.document.write(str) newwin.document.write('</BODY>\n') newwin.document.write('</HTML>\n') newwin.document.close() } </script> </head> <body> <style type="text/css"> #output1,#output2 ,#output3 { width: 300px; word-wrap: break-word; border: solid 1px black; } </style> HTML <div style="width:650px;height:300px;" id="changeMe" > <table cellpadding="5" cellspacing="0" width="100%" style="margin:auto;"> <tr> <td><div class="dynDiv_moveDiv" id="output1" style="font-weight:bold;height:20px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div> </td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output2" style="height:40px;margin-top:30px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output3" style="height:50px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> </table> </div> <tr> <td align="center"><input type="button" value="Print Div" onClick="printContent('changeMe')" /> </td> </tr>

    Read the article

  • Modify jkpanel to load internal content instead of external content

    - by Adam Stone
    I am using an implementation of jkpanel in a vb.net app, the script (see below) loads an external file into the drop down panel. I need to modify this script to load an internal content like a specific div or span so that I can have this nested within the master page. //Drop Down Panel script (March 29th, 08'): By JavaScript Kit: http://www.javascriptkit.com var jkpanel={ controltext: 'Panel Content', $mainpanel: null, contentdivheight: 0, openclose:function($, speed){ this.$mainpanel.stop() //stop any animation if (this.$mainpanel.attr('openstate')=='closed') this.$mainpanel.animate({top: 0}, speed).attr({openstate: 'open'}) else this.$mainpanel.animate({top: -this.contentdivheight+'px'}, speed).attr({openstate: 'closed'}) }, init:function(file, height, speed){ jQuery(document).ready(function($){ jkpanel.$mainpanel=$('<div id="dropdownpanel"><div class="contentdiv"></div><div class="control">'+jkpanel.controltext+'</div></div>').prependTo('body') var $contentdiv=jkpanel.$mainpanel.find('.contentdiv') var $controldiv=jkpanel.$mainpanel.find('.control').css({cursor: 'wait'}) $contentdiv.load(file, '', function($){ var heightattr=isNaN(parseInt(height))? 'auto' : parseInt(height)+'px' $contentdiv.css({height: heightattr}) jkpanel.contentdivheight=parseInt($contentdiv.get(0).offsetHeight) jkpanel.$mainpanel.css({top:-jkpanel.contentdivheight+'px', visibility:'visible'}).attr('openstate', 'closed') $controldiv.css({cursor:'hand', cursor:'pointer'}) }) jkpanel.$mainpanel.click(function(){jkpanel.openclose($, speed)}) }) } } //Initialize script: jkpanel.init('path_to_content_file', 'height of content DIV in px', animation_duration) jkpanel.init('panelcontent.htm', '200px', 500) Does anybody have any idea on how to modify this to do so or even have any tips or pointers to point me in the right direction to start doing so. Cheers

    Read the article

  • ajax response redirect problem

    - by zurna
    When my member registration form correctly filled in and submitted, server responds with redirect link. But my ajax does not redirect the website. I do not receive any errors, where is my mistake? <script type="text/javascript"> $(document).ready(function() { $("[name='submit']").click(function() { $.ajax({ type: "POST", data: $(".form-signup").serialize(), url: "http://www.refinethetaste.com/FLPM/content/myaccount/signup.cs.asp?Process=Add2Member", success: function(output) { if (output.Redirect) { window.location.href = output.Redirect; } else { $('.sysMsg').html(output); } }, error: function(output) { $('.sysMsg').html(output); } }); }); }); </script> asp codes: If Session("LastVisitedURL") <> "" Then Response.Redirect Session("LastVisitedURL") Else Response.Redirect "?Section=myaccount&SubSection=myaccount" End If

    Read the article

  • Click event on submit buttons only fires once

    - by Chris
    I subscribe to the click event on all submit buttons on my page once loaded. All buttons fire off the correct event when clicked, but this only works once. If you click any two buttons in a row the second button submits the form normally as opposed to running the script. What am I doing wrong?. Note: I load the form data from "myurl" using .load() then hook up to the submit buttons' click events in the complete event. $(document).ready(function() { //Load user content $("#passcontent").load("myurl", function() { //subscribe to click events for buttons to post the data back $('input[type=submit]').click(function() { return submitClick($(this)); }); }); }); function submitClick(submitButton) { submitButton.attr("disabled", true); alert(submitButton.closest("form").serialize()); $.post("myurl", submitButton.closest("form").serialize(), function(data) { alert("woop"); $("#passcontent").html(data); }); //Prevent normal form submission process from continuing return false; }

    Read the article

  • jqModal and jquery widget long shot

    - by rod
    Hi All, I just started playing around with jquery widgets within my jqmodals in my mvc app. I know this may be a long shot but I'll take it. Initially, I can click the Add link, get the alert ("which is the prize", watching too much tv), next click cancel to close modal and get the desired results. I can, then, click the Edit link and get the same desired results. However, if I click Edit link first then I try to click the Add link, "forget about it" I don't get the alert (which means my widget did not init). But I can still go back and click Edit and get the prize (the alert message). ajax: "/Home/EditPrintAdLine" and ajax: "/Home/AddPrintAdLine" render the same web user control Any ideas? <%@ Page Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage" %> <asp:Content ID="indexTitle" ContentPlaceHolderID="TitleContent" runat="server"> Home Page </asp:Content> <asp:Content ID="indexContent" ContentPlaceHolderID="MainContent" runat="server"> <h2><%= Html.Encode(ViewData["Message"]) %></h2> <p> To learn more about ASP.NET MVC visit <a href="http://asp.net/mvc" title="ASP.NET MVC Website">http://asp.net/mvc</a>. </p> <div id="printAdLineEditDialog" class="jqmWindow"></div> <div id="printAdDialog" class="jqmWindow"></div> <table> <tr><td><a id="printAdLineItem" href="#">Add a Line Item</a></td></tr> <tr><td><a id="editPrintAdLine" href="#">Edit</a></td></tr> </table> <script type="text/javascript"> $(document).ready(function() { $.widget("ui.my_widget", { _init: function() { alert("My widget was instantiated"); } }); // Add line $('#printAdLineItem').click(function(e) { $('#printAdDialog').jqmShow(this); e.preventDefault(); }); $('#printAdDialog').jqm({ ajax: "/Home/AddPrintAdLine", onLoad: function(hash) { $('#PrintAdLine_RunDate').my_widget(); } }); // Edit line $('#editPrintAdLine').click(function(e) { $('#printAdLineEditDialog').jqmShow(this); e.preventDefault(); }); $('#printAdLineEditDialog').jqm({ ajax: "/Home/EditPrintAdLine", onLoad: function(hash) { $('#PrintAdLine_RunDate').my_widget(); } }); }); </script> </asp:Content>

    Read the article

  • Using argument (this) passed via element eventhandler

    - by Kel
    Hey guys, I want to use the argument I pass (this) in a JS function and treat it as an jQuery variable. Example: <script> function useMe(obj){ $(obj).val(); ... ... ... } </script> <select id="selectid" onChange="useMe(this)"> <option>......</option> </select> Is there a possibility to treat the passed argument as a jQuery element? Btw. I need to do it this way, because the select-element isn't created on load. The select element will be created later asynchronously. So, this won't work: $("select").each(function (i){ var select_id = $(this).attr("id"); $(this).change(function(e){ because it doesn't exist yet. Thanks for your help.

    Read the article

  • JavaScript on jQuery created code never gets called

    - by mare
    This is my view in ASP.NET MVC. <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Administration.Master" Inherits="System.Web.Mvc.ViewPage" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="HeadContent" runat="server"> <script type="text/javascript"> var ddlContentTypes; $(document).ready(function () { ddlContentTypes = $("#ContentTypes"); ddlContentTypes.bind("change", loadCreate); loadCreate(); }); function loadCreate() { var typeId = $("#ContentTypes option:selected").val(); $.get('~/' + typeId + '/Create', function (data) { $("#CreateForm").html(data); }); $("fieldset input").each(function (index, item) { $(item).attr("disabled", true); }); } </script> </asp:Content> <asp:Content ID="Content3" ContentPlaceHolderID="MainContent" runat="server"> <h2> <%=Resources.Localize.CreateWidget %></h2> <p> <% Html.RenderPartial("ContentTypeSelector"); %></p> <div id="CreateForm"> </div> </asp:Content> As you can see, it loads some HTML (actually user control) and adds it to the CreateForm div. This actually works fine. The problem is this $("fieldset input").each(function (index, item) { $(item).attr("disabled", true); }); never runs. The fieldset tag is in the response, so you don't see it here but it's there - everything is returned back fine (I checked with Firebug). Why do the above two lines of JS never run or have any effect?

    Read the article

  • Trying to get a json result back from method in another namespace, having issues

    - by Blankman
    I have a seperate .js file and namespace for json requests. I have another .js file and namespace for the actual logic. I can't seem to get the result back in my logic layer. var jsonResult = Blah.Data.LoadAggregates(); alert(jsonResult); alert(jsonResult.d.length); alert(jsonResult.length); all of the above calls are returning undefined. Blah.RegisterNamespace("Blah.Data"); (function(Data) { Data.LoadAggregates = function() { $.ajax({ type: "POST", url: "asdf.asmx/GetAggregates", data: "{}", contentType: "application/json; charset=utf-8", dataType: "json", success: function(data) { ??????? }, error: function(msg) { alert("error" + msg); } }); }; })(Blah.Data);

    Read the article

  • Prototypes Object.extend with multiple objects that contain there own functions.

    - by erickreutz
    How would I achieve something along the lines of this.. var Persistence = new Lawnchair('name'); Object.extend(Lawnchair.prototype, { UserDefaults: { setup: function(callback) { // "save" is a native Lawnchair function that doesnt //work because // "this" does not reference "Lawnchair" // but if I am one level up it does. Say if I defined // a function called UserDefaults_setup() it would work // but UserDefaults.setup does not work. this.save({key: 'key', value: 'value'}); // What is this functions scope? // How do I access Lawnchairs "this" } }, Schedule: { refresh: function(callback) { } } }); //this get called but doesnt work. Persistence.UserDefaults.setup();

    Read the article

  • trying to fade out a top div on hover to reveal working links in text below using JQuery

    - by Heath
    I need to fade a div (and image) to reveal a div underneath (text with clickable links) using jQuery. <script> $(document).ready(function(){ $("img.a").hover( function() { $(this).stop().animate({"opacity": "0"}, "slow"); }, function() { $(this).stop().animate({"opacity": "1"}, "slow"); }); }); </script> Used the above code and all worked well, until I went to click the links. Seems the top hidden div is preventing me from doing so. Tried the replaceWith function and that allowed me to click the links too - but couldn't get it to go back to showing original div when I moused out. Also, bossman wants the transition to be gradual - like a fade... Any suggestions? Many thanks! Heath

    Read the article

  • jQuery Ajax returns the whole page

    - by Sophia Gavish
    Dear all, I have a jquery-ajax function that sends data to a php script and the problem is with the return value, it returns the whole page instead of single value. Thank you for your time and help. $("#ajaxBtn").click(function(){ var inputText = $("#testText").val(); $.ajax({ type: "POST", url: "index.php", data: "testAjax="+inputText, dataType: "html", success: function(html){ alert(html); } }); });

    Read the article

  • I have a filter for jquery masonry - but I want to filter moomasonry

    - by Jason
    Hi, I'm using jquery masonry for layout. But I am considering moving to mootools. I have found a masonry port to mootools, called moomasonry - http://www.crionics.com/products/opensource/mooMasonry/Demos/basic.html With help here, I have a filter on the masonry divs by class: $('a.filter').click(function(){ filterBoxes(this.id); }) function filterBoxes(klass){ if (klass == "all") { klass = "box" } $('#holder').find('.' + klass) .hide() .appendTo('#main') .fadeIn('200') $('#main').find('.box:not(.' + klass + ')') .fadeOut( '200', function(){ $(this).appendTo('#holder') ; }); setTimeout(function(){ $('#main').masonry() },500); } But, how would I filter divs by class in mootools? and have it reload masonry after each filter. See my site for example: http://jasondaydesign.com/masonry_demo/

    Read the article

  • How to expand and collapse all accoutns using Jquery..

    - by kumar
    Here is my code to expand and collapse all the users on the grid.. But problem is without clicking expand buttong if I open any user..its opening fyn,, but if I click again on the expand button happening the opened subgrid is closing and closing one is opening... here is my code can anybody tell me what's the wrong with this. <script type="text/javascript"> $(document).ready(function() { $('#tmpOpen').click(function() { var value = document.getElementById("tmpOpen").value; if (value == "Expand All Accounts") { document.getElementById("tmpOpen").value = "Collapse"; loadAll(); } else { document.getElementById("tmpOpen").value = "Expand"; loadAll(); } }); function loadAll() { var o = true; $('#Grid1 tr[role="row"] td a').each(function(row) { if (o) { $(this).trigger('click'); } }); } }); </script>

    Read the article

  • JQuery never reaches success or fail on aspx returning json.

    - by David
    Basicaly I have my aspx page doing <% Response.Clear(); Response.Write("{\"Success\": \"true\" }"); Response.End(); %> My JQuery code is function DoSubmit(r) { if (r == null || r.length == 0 || formdata == null || formdata.length == 0) return; for (i = 0; i < formdata.length; i++) { var fd = formdata[i]; r[fd.Name] = fd.Value; } r["ModSeq"] = tblDef.ModSeq; jQuery.ajax({ url: "NashcoUpdate.aspx" , succsess: doRow , error: DoSubmitError , complete: DoSubmitComplete , dataType: "json" , cache: false , data: r , type: "post" }) } When I call the DoSubmit() function every thing works but the doRow or DoSubmitError functions never get called only the DoSubmitComplete function. When I look at the response text in teh DoSubmitComple function it is {"Success": "true" } Every JSON tester I have tried says that this is valied JSON. What am I doing wrong here?

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Unique JQuery Events for a Class

    - by Daniel Macias
    I am trying to create a class that can send a unique jQuery event. Example: function Bomb(id) { this.evnt = $.Event("BOOM!_" + id); this.detonate = function() { $(document).trigger(evnt); }; } var firecracker = new Bomb(); var nuclearbomb = new Bomb(); $(document).bind(firecracker.evnt.type, function(){ // It's the fourth of july!!! }); $(document).bind(nuclearbomb.evnt.type, function(){ // We're dead }); firecracker.detonate(); nuclearbomb.detonate(); How can I create a unique event within the Bomb class without having to pass in an ID to create a unique event string for the class?

    Read the article

  • jQuery: Use of undefined constant data assumed 'data'

    - by morpheous
    I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • JQuery Help: toggle() is not working properly

    - by John Smith
    Hi All, I'm trying to use JQuery toggle functionality, but not able to use properly. Instead of smooth slide up and down, it goes very fast and not in an animated manner. I want to achieve sliding effect in my code, like this has (Please see Website Design, Redesign Services slider): Here is my code: HTML: <div> <div class="jquery_inner_mid"> <div class="main_heading"> <a href="#"> <img src="features.jpg" alt="" title="" border="0" /></a> </div> <div class="plus_sign"> <img id="imgFeaturesEx" src="images/plus.jpg" alt="" title="" border="0" /> <img id="imgFeaturesCol" src="images/minus.jpg" alt="" title="" border="0" /></div> <div class="toggle_container"> <div id="divMain" > </div> </div> </div> <div class="jquery_inner_mid"> <div class="main_heading"> <img src="About.jpg" alt="" title="" /></div> <div class="plus_sign"> <img id="imgTechnoEx" src="images/plus.jpg" alt="" title="" border="0" /> <img id="imgTechnoCol" src="images/minus.jpg" alt="" title="" border="0" /></div> <div class="toggle_container"> <div id="divTechnossus" > </div> </div> </div> </div> JQuery: $(function() { document.getElementById('imgFeaturesCol').style.display = 'none'; document.getElementById('imgTechnoCol').style.display = 'none'; $('#imgFeaturesEx').click(function() { $.getJSON("/Visitor/GetFeatureInfo", null, function(strInfo) { document.getElementById('divMain').innerHTML = strInfo; }); $("#divMain").toggle("slow"); document.getElementById('imgFeaturesEx').style.display = 'none'; document.getElementById('imgFeaturesCol').style.display = 'block'; }); $('#imgFeaturesCol').click(function() { document.getElementById('divMain').innerHTML = ""; $("#divMain").toggle("slow"); document.getElementById('imgFeaturesCol').style.display = 'none'; document.getElementById('imgFeaturesEx').style.display = 'block'; }); $('#imgTechnoEx').click(function() { $.getJSON("/Visitor/GetTechnossusInfo", null, function(strInfo) { document.getElementById('divTechnossus').innerHTML = strInfo; }); $("#divTechnossus").slideToggle("slow"); document.getElementById('imgTechnoEx').style.display = 'none'; document.getElementById('imgTechnoCol').style.display = 'block'; }); $('#imgTechnoCol').click(function() { document.getElementById('divTechnossus').innerHTML = ""; $("#divTechnossus").slideToggle("slow"); document.getElementById('imgTechnoCol').style.display = 'none'; document.getElementById('imgTechnoEx').style.display = 'block'; }); });

    Read the article

  • jQuery ajax post dynamic url insertion

    - by Kirill
    $.ajax({ type: "POST", url: "OMFG.php", data: info, success: function(){ }}); is what I'm using atm as a test and it works fine. I need to get the url from the link I'm clicking, so I do: var url = $(this).attr("href"); which works fine if I alert it out(the link includes http://samedomain.com/etc.php), but the ajax function doesn't post if I insert it into the ajax code: $.ajax({ type: "POST", url: url, data: info, success: function(){ }}); Please help, as I'm screwed without this working.

    Read the article

< Previous Page | 325 326 327 328 329 330 331 332 333 334 335 336  | Next Page >