Search Results

Search found 38817 results on 1553 pages for 'inline function'.

Page 332/1553 | < Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >

  • So many ways to bind an event

    - by XGreen
    There are various ways to bind events to elements in jquery .click , .bind, .live, .delegate, saving events data in .data etc which is the most superior method among these and why? wouldn't a single pattern like this be more beneficial? $('selector').bind({ event: 'click mouseover ...', keepAlive: (true, false, ...), trigfunction: (function() { // I run for click }, function() { // i run for mouseover }, function() { ///... }) });

    Read the article

  • jquery ui dialog button

    - by mike
    Hello, With a jQuery UI dialog, I need to be able to set tooltips on buttons... I have the following code: buttons: { 'My Button' : function(e) { $(e.target).mouseover(function() { alert('test'); }); } This allows me to do something on "mouseover" but only once the button has been clicked. What do I need to do in order to make this function before the button has been clicked? Thanks

    Read the article

  • How do I bind a jQuery Tools overlay event to an existing overlay?

    - by Paul
    Say when the page loads, this code runs: jQuery(document).ready(function($){ $('#overlay').overlay( api: true ); }); How would I bind an event to it? I've tried: $('#overlay').onBeforeLoad( function(){ alert('Hi'); }); $('#overlay').bind( 'onBeforeLoad', function(){ alert('Hi'); }); var api = $('#overlay').data('overlay'); api.onBeforeLoad(function(){ alert('Hi') }); When I do: alert(api.getContent().attr('id')); An alert pops up with '#overlay' inside. When the overlay is open and I run: alert(api.isOpened()); An alert pops up with 'false' inside. Thanks in advance.

    Read the article

  • Search for content in functions with regex

    - by Marlun
    Hello, How would I with regular expression search for functions which contains the use of a global variable without running "global $var" first? The files looks like this: class TestClass { function correctFunc() { global $var; $name = $var->name; } function invalidFuncIWantToFind() { $age = $var->user->age; } } I want to find the function names of all the invalidFuncIWantToFind. At work this would have really speeded up our work but I didn't get how to do it.

    Read the article

  • Create Marker Categories & Display Markers on Click Only

    - by MizAkita
    I am trying to create marker categories and display markers on click... For example, "Eat", "Banks", "Places of Interest" and clicking on them would produce only the markers in those categories. You can see it live HERE Here is a code snippet: //<![CDATA[ //<![CDATA[ var map = null; var gmarkers = []; var gicons = []; var icon = []; function initialize() { var myOptions = { zoom: 13, center: new google.maps.LatLng(37.979183,-121.302381), mapTypeControl: true, mapTypeControlOptions: {style: google.maps.MapTypeControlStyle.DROPDOWN_MENU}, navigationControl: true, mapTypeId: google.maps.MapTypeId.ROADMAP } map = new google.maps.Map(document.getElementById("map_canvas"), myOptions); google.maps.event.addListener(map, 'click', function() { infowindow.close(); }); // Add markers to the map // Set up three markers with info windows ///////////////////////// EATS ////////////////////////////////////////////// var point = new google.maps.LatLng(37.988012,-121.311901); var image = 'icons/orangepointer.png'; var marker = createMarker(point,'<div style="width:205"><center><img src="icons/tigeryogurt.jpg" /></center><br><b>Tiger Yogurt</b><small><br>4343 Pacific Avenue<br>209.952.6042<br><br><a href="http://maps.google.com/maps?saddr=&daddr=' + point.toUrlValue() + '" target ="_blank">Get Directions<\/a></small><\/div>', image); // this will be gmarkers[0] var point = new google.maps.LatLng(37.987054,-121.311655); var image = 'icons/orangepointer.png'; var marker = createMarker(point,'<div style="width:205"><center><img src="icons/mwbakery.jpg" /></center><br><b>M&W Bakery<br>Cakes & Sandwiches</b><small><br>4343 Pacific Avenue<br>209.473.3828<br><br>On the web visit:<br><a href="http://www.mandwdutchamericanbakery.com" target ="_blank">MandWDutchAmericanBakery.com<\/a><br><br><a href="http://maps.google.com/maps?saddr=&daddr=' + point.toUrlValue() + '" target ="_blank">Get Directions<\/a></small><\/div>', image); // this will be gmarkers[1] Currently, all markers display. I can easily get the markers not to display... however, i am trying to have only categories display and individual listings to display on click only! CREATE MARKER FUNCTION: } var infowindow = new google.maps.InfoWindow( { size: new google.maps.Size(150,50) }); function triggerClick(i) { google.maps.event.trigger(gmarkers[i],"click") }; function createMarker(latlng, html, img) { var contentString = html; var marker = new google.maps.Marker({ position: latlng, map: map, icon: img, zIndex: Math.round(latlng.lat()*-100000)<<5 }); google.maps.event.addListener(marker, 'click', function() { infowindow.setContent(contentString); infowindow.open(map,marker); }); gmarkers.push(marker); }

    Read the article

  • Why is this XMLHttpRequest sample from Mozilla is not working in Firefox 3?

    - by j0rd4n
    I'm trying to get the sample code from Mozilla that consumes a REST web service to work under Firefox 3.0.10. The following code does NOT work in Firefox but does in IE 8! Why is this not working? Does IE 8 have support for XMLHttpRequest? Most examples I've seen use the ActiveX allocation. What should I be doing? XMLHttpRequest seems more standardized. Sample: var req = new XMLHttpRequest(); req.open('GET', 'http://localhost/myRESTfulService/resource', false); // throws 'undefined' exception req.send(null); if(req.status == 0) dump(req.responseText); The open statement is throwing an exception with the description 'undefined'. This is strange as I allocate the req object, am running it in Firefox, and checked to make sure it is defined before calling open (which it says it is of type 'object'). I've also tried the asynchronous version of this with no luck. EDIT 2: Below is my most recent code: function createRequestObject() { if( window.XMLHttpRequest ) { return new XMLHttpRequest(); } else if( window.ActiveXObject ) { return new ActiveXObject( "Microsoft.XMLHTTP" ); } return null; } function handleResponse( req ) { document.writeln( "Handling response..." ); // NEVER GETS CALLED if( req.readyState == 0 ) { document.writeln( "UNITIALIZED" ); } else if( req.readyState == 1 ) { document.writeln( "LOADING" ); } else if( req.readyState == 2 ) { document.writeln( "LOADED" ); } else if( req.readyState == 3 ) { document.writeln( "INTERACTIVE" ); } else if( req.readyState == 4 ) { document.writeln( "COMPLETE" ); if( req.status == 200 ) { document.writeln( "SUCCESS" ); } } } document.writeln( "" ); var req = createRequestObject(); try { document.writeln( "Opening service..." ); req.onreadystatechange = function() { handleResponse( req ); }; req.open('POST', 'http://localhost/test/test2.txt', true); // WORKS IN IE8 & NOT FIREFOX document.writeln( "Sending service request..." ); req.send(''); document.writeln( "Done" ); } catch( err ) { document.writeln( "ERROR: " + err.description ); } EDIT 3: Alright, I reworked this in jQuery. jQuery works great in IE but it throws 'Undefined' when running from Firefox. I double checked and 'Enable JavaScript' is turned on in Firefox - seems to work fine in all other web pages. Below is the jQuery code: function handleResponse( resp ) { alert( "Name: " + resp.Name ); alert( "URL: " + resp.URL ); } $(document).ready( function() { $("a").click( function(event) { try { $.get( "http://localhost/services/ezekielservices/configservice/ezekielservices.svc/test", "{}", function(data) { handleResponse( data ); }, "json" ); } catch( err ) { alert("'$.get' threw an exception: " + err.description); } event.preventDefault(); }); } ); // End 'ready' check Summary of Solution: Alright, web lesson 101. My problem was indeed cross-domain. I was viewing my site unpublished (just on the file system) which was hitting a published service. When I published my site under the same domain it worked. Which also brings up an important distinction between IE and Firefox. When IE experiences this scenario, it prompts the user whether or not they accept the cross-domain call. Firefox throws an exception. While I'm fine with an exception, a more descriptive one would have been helpful. Thanks for all those who helped me.

    Read the article

  • Zend framework controller action helper

    - by guptanikhilchandra
    I am getting fatal error after adding the action helper class. I am trying to load layout corresponding to called layout. Following is my code snippet: First of all i added a helper class under application/controller/helpers: class Zend_Controller_Action_Helper_Layout extends Zend_Controller_Action_Helper_Abstract { public $pluginLoader; public function __construct() { // TODO Auto-generated Constructor $this->pluginLoader = new Zend_Loader_PluginLoader (); } public function preDispatch() { $bootstrap = $this->getActionController()->getInvokeArg('bootstrap'); $config = $bootstrap->getOptions(); $module = $this->getRequest()->getModuleName(); if (isset($config[$module]['resources']['layout']['layout'])) { $layoutScript = $config[$module]['resources']['layout']['layout']; $this->getActionController()->getHelper('layout')->setLayout($layoutScript); } } } Then i added a loader in bootstrap.php: protected function _initLayoutHelper() { $this->bootstrap('frontController'); Zend_Controller_Action_HelperBroker::addPath(APPLICATION_PATH .'/controllers/helpers'); $layout = Zend_Controller_Action_HelperBroker::addHelper(new Zend_Controller_Action_Helper_Layout()); } Following is my application.ini: [production] autoloaderNamespaces.tree = "Tree_" phpSettings.display_startup_errors = 0 phpSettings.display_errors = 0 includePaths.library = APPLICATION_PATH "/../library" bootstrap.path = APPLICATION_PATH "/Bootstrap.php" bootstrap.class = "Bootstrap" resources.frontController.controllerDirectory = APPLICATION_PATH "/controllers" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.helperDirectory = APPLICATION_PATH "/controllers/helpers" resources.modules[] = "" contact.resources.frontController.defaultControllerName = "index" resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.layout.layout = layout admin.resources.layout.layout = admin admin.resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.view[] = [staging : production] [testing : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 [development : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 While running this code i am getting following errors: Warning: include(Zend\Controller\Action\Helper\LayoutLoader.php) [function.include]: failed to open stream: No such file or directory in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Warning: include() [function.include]: Failed opening 'Zend\Controller\Action\Helper\LayoutLoader.php' for inclusion (include_path='D:\personal\proj\renovate\application/../library;D:\personal\proj\renovate\library;.;C:\php5\pear') in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Fatal error: Class 'Zend_Controller_Action_Helper_LayoutLoader' not found in D:\personal\proj\renovate\application\Bootstrap.php on line 33 Kindly let me know, how can i come out from this issue. I am beginner in Zend Framework. Thanks Nikhil

    Read the article

  • How to convert this jquery code into noconflict

    - by metal-gear-solid
    will we have to replace every $ with jquery? $(document).ready(function() { $('.tabs a').click(function(){ switch_tabs($(this)); }); switch_tabs($('.defaulttab')); }); function switch_tabs(obj) { $('.tab-content').hide(); $('.tabs a').removeClass("selected"); var id = obj.attr("rel"); $('#'+id).show(); obj.addClass("selected"); }

    Read the article

  • Can I interrupt javascript code and then continue on a keystroke?

    - by Brian Ramsay
    I am porting an old game from C to Javascript. I have run into an issue with display code where I would like to have the main game code call display methods without having to worry about how those status messages are displayed. In the original code, if the message is too long, the program just waits for the player to toggle through the messages with the spacebar and then continues. This doesn't work in javascript, because while I wait for an event, all of the other program code continues. I had thought to use a callback so that further code can execute when the player hits the designated key, but I can't see how that will be viable with a lot of calls to display.update(msg) scattered throughout the code. Can I architect things differently so the event-based, asynchronous model works, or is there some other solution that would allow me to implement a more traditional event loop? Am I making sense? Example: // this is what the original code does, but obviously doesn't work in Javascript display = { update : function(msg) { // if msg is too long // wait for user input // ok, we've got input, continue } }; // this is more javascript-y... display = { update : function(msg, when_finished) { // show part of the message $(document).addEvent('keydown', function(e) { // display the rest of the message when_finished(); }); } }; // but makes for amazingly nasty game code do_something(param, function() { // in case do_something calls display I have to // provide a callback for everything afterwards // this happens next, but what if do_the_next_thing needs to call display? // I have to wait again do_the_next_thing(param, function() { // now I have to do this again, ad infinitum } }

    Read the article

  • modify this code .. please help me?

    - by Sam
    i wana modify this code from static choices to dynamic this for 3 choices var PollhttpObject=null; function DoVote() {if(document.getElementById('PollRadio1').checke d)DoVote_Submit(1);else if(document.getElementById('PollRadio2').checked)DoVote_Submit(2);else if(document.getElementById('PollRadio3').checked)DoVote_Submit(3);else alert('?????: ?????? ?????? ??? ?????????? ??????? ?? ????? ??? ?? ???????');return false;} function DisbalePoll(TheCase) {document.getElementById('VoteBttn').onclick=function(){alert('!?????? ??? ?? ??????? ??????');} document.getElementById('PollRadio1').disabled='true';document.getElementById('PollRadio2').disabled='true';document.getElementById('PollRadio3').disabled='true';if(TheCase=='EXPIRED') {document.getElementById('VoteBttn').src='images/design/VoteBttn_OFF.jpg';document.getElementById('ResultBttn').src='images/design/ResultsBttn_OFF.jpg';document.getElementById('VoteBttn').onclick='';document.getElementById('ResultBttn').onclick='';document.getElementById('ResultBttn').style.cursor='';document.getElementById('VoteBttn').style.cursor='';}} function DoVote_Submit(VoteID) {if(VoteID!=0)DisbalePoll();try{PollhttpObject=getHTTPObject();if(PollhttpObject!=null) {PollhttpObject.onreadystatechange=PollOutput;PollhttpObject.open("GET","Ajax.aspx?ACTION=POLL&VOTEID="+ VoteID+"&RND="+ Math.floor(Math.random()*10001),true);PollhttpObject.send(null);}} catch(e){} return false;} function PollOutput(){if(PollhttpObject.readyState==4) {var SearchResult=PollhttpObject.responseText;document.getElementById('PollProgress').style.display='none';document.getElementById('PollFormDiv').style.display='block';if(SearchResult.length=2&&SearchResult.substr(0,2)=='OK') {var ReturnedValue=SearchResult.split("#");document.getElementById('PollBar1').style.width=0+'px';document.getElementById('PollBar2').style.width=0+'px';document.getElementById('PollBar3').style.width=0+'px';document.getElementById('PollRate1').innerHTML="0 (0%)";document.getElementById('PollRate2').innerHTML="0 (0%)";document.getElementById('PollRate3').innerHTML="0 (0%)";window.setTimeout('DrawPollBars(0, '+ ReturnedValue[1]+', 0, '+ ReturnedValue[2]+', 0, '+ ReturnedValue[3]+')',150);} else if(SearchResult.length=2&&SearchResult.substr(0,2)=='NO') {alert("?????: ??? ??? ???????? ?????");}} else {document.getElementById('PollProgress').style.display='block';document.getElementById('PollFormDiv').style.display='none';}} function DrawPollBars(Bar1Var,Bar1Width,Bar2Var,Bar2Width,Bar3Var,Bar3Width) {var TotalVotes=parseInt(Bar1Width)+parseInt(Bar2Width)+parseInt(Bar3Width);var IncVal=parseFloat(TotalVotes/10);var NewBar1Width=0;var NewBar2Width=0;var NewBar3Width=0;var Bar1NextVar;var Bar2NextVar;var Bar3NextVar;if(parseInt(parseInt(Bar1Var)*200/TotalVotes)0)NewBar1Width=parseInt(Bar1Var)*200/TotalVotes;else if(Bar1Var0)NewBar1Width=1;else NewBar1Width=0;if(parseInt(parseInt(Bar2Var)*200/TotalVotes)0)NewBar2Width=parseInt(Bar2Var)*200/TotalVotes;else if(Bar2Var0)NewBar2Width=1;else NewBar2Width=0;if(parseInt(parseInt(Bar3Var)*200/TotalVotes)0)NewBar3Width=parseInt(Bar3Var)*200/TotalVotes;else if(Bar3Var0)NewBar3Width=1;else NewBar3Width=0;document.getElementById('PollBar1').style.width=NewBar1Width+'px';document.getElementById('PollBar2').style.width=NewBar2Width+'px';document.getElementById('PollBar3').style.width=NewBar3Width+'px';document.getElementById('PollRate1').innerHTML=parseFloat(Bar1Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar1Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate2').innerHTML=parseFloat(Bar2Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar2Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate3').innerHTML=parseFloat(Bar3Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar3Var)/TotalVotes*100).toFixed(1)+"%)";if(Bar1Var!=Bar1Width||Bar2Var!=Bar2Width||Bar3Var!=Bar3Width) {if(parseFloat(Bar1Var)+IncVal<=parseInt(Bar1Width))Bar1NextVar=parseFloat(Bar1Var)+IncVal;else Bar1NextVar=Bar1Width;if(parseFloat(Bar2Var)+IncVal<=parseInt(Bar2Width))Bar2NextVar=parseFloat(Bar2Var)+IncVal;else Bar2NextVar=Bar2Width;if(parseFloat(Bar3Var)+IncVal<=parseInt(Bar3Width))Bar3NextVar=parseFloat(Bar3Var)+IncVal;else Bar3NextVar=Bar3Width;window.setTimeout('DrawPollBars('+ Bar1NextVar+', '+ Bar1Width+', '+ Bar2NextVar+', '+ Bar2Width+', '+ Bar3NextVar+', '+ Bar3Width+')',80); }}

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Dealing with multiple Javascript IF statements.

    - by Joey
    Is it possible to put multiple IF statements in Javascript? If so, I'm having a fair amount of trouble with the statement below. I was wondering if you can put another IF statement in between if (data == 'valid') AND else? I want to add another if data =='concept') between the two. if (data == 'valid') { $("#file").slideUp(function () { $("#file").before('<div class="approvedMessage">WIN WIN WIN!</div>'); setTimeout(ApprovedProof, 5000); }); function ApprovedProof() { $("#file").slideDown(); $('.approvedMessage').fadeOut(); } } else { $("#file").slideUp(function () { $("#file").before('<div class="deniedMessage">NO NO NO!</div>'); setTimeout(DeniedProof, 5000); }); function DeniedProof() { $("#file").slideDown(); $('.deniedMessage').fadeOut(); } }

    Read the article

  • Very basic Javascript constructors problem

    - by misha-moroshko
    Hi, In the following JavaScript code main() is called. My question is why the second constructor is called rather than the first one ? What am I missing here ? Thanks !! function AllInputs() { alert("cons 1"); this.radioInputs = []; alert(this); } function AllInputs(radioElement) { alert("cons 2"); this.radioInputs = [radioElement]; alert(this); } AllInputs.prototype.toString = function() { return "[object AllInputs: radioInputs: " + this.radioInputs.length + "]"; } function main() { var result = new AllInputs(); }

    Read the article

  • Jquery FancyBox target specific DIV ID?

    - by MrThomas
    How do I get Fancy box to target a specific DIV ID on a page and not request the whole page in the fancybox.? This my code so fare $(function() { $(".style_image a").live('click', function(event) { $(".style_image a").find("#show_style").fancybox(); }); }); This don't work? I originally tried the following: $(function() { $(".style_image a").live('click', function(event) { $(this.href + " #show_style").fancybox(); }); }); Not sure how this done, or if it is even possible? here are the doc's

    Read the article

  • Problem with jQuery's fade in/out in Firefox

    - by GaVrA
    I already asked here with no luck, but feel free to read it: http://groups.google.com/group/jquery-en/browse%5Fthread/thread/fdf7a584b30d4bb9 Hmm check out my site: http://www.crtaci.info/ on top-right position i have search field. When you move your mouse over there small text shows up that says: Napredna pretraga Now, for some reason those letters change color to like yellow for very short period of time in ff 3.5 and to some strange color in safari 4.0.2 for win. In ie8, opera and chrome it works just the way it should, white letters stay white during the animation. Any sugestions? here is function that do this job ;) $('#header_search').hover(function() { $('#naprednaPretraga').stop({clearQueue:true}).show().animate({"opacity" : 1},500); }, function(){ $('#naprednaPretraga').stop({clearQueue:true}).animate({"opacity" : 0},500,function() { $('#naprednaPretraga').hide(); }); });

    Read the article

  • pass data from popup to parent

    - by user522962
    I have a parent w/ a popup child. When parent loads, I have to call a function within the popup without showing the popup (thus, I load "pupLove" but don't include it in layout)....I then pass this data to the parent. When the user manually clicks another button to open the popup, the same function is called & data passed to the parent. However, I am not able to pass dg.length to the parent. I believe the root problem is that I am loading "pupLove" & thus the parents are getting confused.....I'm guessing if I get rid of "pupLove" I can pass the data correctly but will need to call the child's function at creationComplete of the parent....how do I do that? Here's my parent: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" backgroundColor="green" width="50%" height="100%" xmlns:local="*" > <fx:Script> <![CDATA[ import pup; import mx.managers.PopUpManager; public function showPup(evt:MouseEvent):void { var ttlWndw:pup = PopUpManager.createPopUp(this, pup, true) as pup; PopUpManager.centerPopUp(ttlWndw); } ]]> </fx:Script> <mx:VBox> <local:pup id="pupLove" visible="false" includeInLayout="false" /> <s:Button click="showPup(event);" label="launch Pup" /> <mx:Text id="Ptest" color="black" text="from Parent:{pupLove.dg.length}" /> </mx:VBox> </s:Application> And a popup child called 'pup.mxml': <?xml version="1.0" encoding="utf-8"?> <s:Group xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" width="400" height="300"> <fx:Script> <![CDATA[ public function init():void{ // send php call } import mx.events.CloseEvent; import mx.managers.PopUpManager; private function removePup(evt:Event):void { PopUpManager.removePopUp(this); } ]]> </fx:Script> <fx:Declarations> <s:ArrayCollection id="dg"> </s:ArrayCollection> </fx:Declarations> <s:TitleWindow width="100%" height="100%" close="removePup(event)"> <mx:VBox> <mx:Text id="test" color="red" text="from Child:{dg.length}" /> <s:Button label="add Items" click="dg.addItem({id:'cat'})" /> </mx:VBox> </s:TitleWindow> </s:Group> UPDATE: I guess my question can be more easily stated as: "is there a way to call a child's function from the parent without actually loading the child?"

    Read the article

  • Using ember-resource with couchdb - how can i save my documents?

    - by Thomas Herrmann
    I am implementing an application using ember.js and couchdb. I choose ember-resource as database access layer because it nicely supports nested JSON documents. Since couchdb uses the attribute _rev for optimistic locking in every document, this attribute has to be updated in my application after saving the data to the couchdb. My idea to implement this is to reload the data right after saving to the database and get the new _rev back with the rest of the document. Here is my code for this: // Since we use CouchDB, we have to make sure that we invalidate and re-fetch // every document right after saving it. CouchDB uses an optimistic locking // scheme based on the attribute "_rev" in the documents, so we reload it in // order to have the correct _rev value. didSave: function() { this._super.apply(this, arguments); this.forceReload(); }, // reload resource after save is done, expire to make reload really do something forceReload: function() { this.expire(); // Everything OK up to this location Ember.run.next(this, function() { this.fetch() // Sub-Document is reset here, and *not* refetched! .fail(function(error) { App.displayError(error); }) .done(function() { App.log("App.Resource.forceReload fetch done, got revision " + self.get('_rev')); }); }); } This works for most cases, but if i have a nested model, the sub-model is replaced with the old version of the data just before the fetch is executed! Interestingly enough, the correct (updated) data is stored in the database and the wrong (old) data is in the memory model after the fetch, although the _rev attribut is correct (as well as all attributes of the main object). Here is a part of my object definition: App.TaskDefinition = App.Resource.define({ url: App.dbPrefix + 'courseware', schema: { id: String, _rev: String, type: String, name: String, comment: String, task: { type: 'App.Task', nested: true } } }); App.Task = App.Resource.define({ schema: { id: String, title: String, description: String, startImmediate: Boolean, holdOnComment: Boolean, ..... // other attributes and sub-objects } }); Any ideas where the problem might be? Thank's a lot for any suggestion! Kind regards, Thomas

    Read the article

  • This regx does not work only in Chrome

    - by Deeptechtons
    Hi i just put up a validation function in jScript to validate filename in fileupload control[input type file]. The function seems to work fine in FF and sometimes in ie but never in Chrome. Basically the function tests if File name is atleast 1 char upto 25 characters long.Contains only valid characters,numbers [no spaces] and are of file types in the list. Could you throw some light on this function validate(Uploadelem) { var objRgx = new RegExp(/^[\w]{1,25}\.*\.(jpg|gif|png|jpeg|doc|docx|pdf|txt|rtf)$/); objRgx.ignoreCase = true; if (objRgx.test(Uploadelem.value)) { document.getElementById('moreUploadsLink').style.display = 'block'; } else { document.getElementById('moreUploadsLink').style.display = 'none'; } }

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • Can I find out the return value before returning while debugging in Visual Studio

    - by doekman
    Take the following function: DataTable go() { return someTableAdapter.getSomeData(); } When I set a breakpoint in this function, is there a possibility to inspect the returned value? The "go" function is directly coupled to a datagrid in an aspx page. The only way to inspect the returned datatable, is to use a temporary variable... However, that's a bit inconvenient. Isn't there another way?

    Read the article

  • emacs windows, distribute the width through the frame

    - by Gauthier
    I used once a very nice emacs function that set all my windows (emacs windows, not frames) width evenly. If you open emacs and do C-x 3 twice in a row, you get three vertical windows. Then running the function I am looking for makes the width of these windows the same. I can't for the life of me find this function again. Wouldn't someone help me to: find the name of the function give me the keyboard shortcut if any tell me what I should have done to find the answer by myself Thanks!

    Read the article

  • C puzzle: Output of printf should be '5' always

    - by pragadheesh
    Hi, I found this puzzle in a C aptitude paper. void change() { //write something in this function so that output of printf in main function //should always give 5.you can't change the main function } int main() { int i = 5; change(); i = 10; printf("%d", i); return 0; } Any solutions.?

    Read the article

  • AS3: Adding get/set methods to a class via prototype

    - by LiraNuna
    I'm looking for a way to extend a class via prototype by adding a get and set functions. The following code will add a function to the class' prototype: MyClass.prototype.newMethod = function(... args) { }; However I want to add both a get and set functions. I tried: MyClass.prototype.fakeProperty = get function(... args) { }; MyClass.prototype.fakeProperty = set function(... args) { }; But that seem to throw compile errors. Is this even possible? Is there some 'internal' naming convention for get/set functions? I am not looking for answers such as 'create a new class and new get/set functions there'.

    Read the article

  • Link User32 with gcc

    - by Tim Cooper
    I have a C program which has a function call that is defined in windows.h (which I have included), however, when I try and compile it with gcc, I get the error: warning: implicit declaration of function `LockWorkStation' I looked at the MSDN documentation and I see that this function is the User32 library file, and I was wondering how I would go about linking that to my file.

    Read the article

< Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >