Search Results

Search found 38817 results on 1553 pages for 'inline function'.

Page 332/1553 | < Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >

  • Zend framework controller action helper

    - by guptanikhilchandra
    I am getting fatal error after adding the action helper class. I am trying to load layout corresponding to called layout. Following is my code snippet: First of all i added a helper class under application/controller/helpers: class Zend_Controller_Action_Helper_Layout extends Zend_Controller_Action_Helper_Abstract { public $pluginLoader; public function __construct() { // TODO Auto-generated Constructor $this->pluginLoader = new Zend_Loader_PluginLoader (); } public function preDispatch() { $bootstrap = $this->getActionController()->getInvokeArg('bootstrap'); $config = $bootstrap->getOptions(); $module = $this->getRequest()->getModuleName(); if (isset($config[$module]['resources']['layout']['layout'])) { $layoutScript = $config[$module]['resources']['layout']['layout']; $this->getActionController()->getHelper('layout')->setLayout($layoutScript); } } } Then i added a loader in bootstrap.php: protected function _initLayoutHelper() { $this->bootstrap('frontController'); Zend_Controller_Action_HelperBroker::addPath(APPLICATION_PATH .'/controllers/helpers'); $layout = Zend_Controller_Action_HelperBroker::addHelper(new Zend_Controller_Action_Helper_Layout()); } Following is my application.ini: [production] autoloaderNamespaces.tree = "Tree_" phpSettings.display_startup_errors = 0 phpSettings.display_errors = 0 includePaths.library = APPLICATION_PATH "/../library" bootstrap.path = APPLICATION_PATH "/Bootstrap.php" bootstrap.class = "Bootstrap" resources.frontController.controllerDirectory = APPLICATION_PATH "/controllers" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.helperDirectory = APPLICATION_PATH "/controllers/helpers" resources.modules[] = "" contact.resources.frontController.defaultControllerName = "index" resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.layout.layout = layout admin.resources.layout.layout = admin admin.resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.view[] = [staging : production] [testing : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 [development : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 While running this code i am getting following errors: Warning: include(Zend\Controller\Action\Helper\LayoutLoader.php) [function.include]: failed to open stream: No such file or directory in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Warning: include() [function.include]: Failed opening 'Zend\Controller\Action\Helper\LayoutLoader.php' for inclusion (include_path='D:\personal\proj\renovate\application/../library;D:\personal\proj\renovate\library;.;C:\php5\pear') in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Fatal error: Class 'Zend_Controller_Action_Helper_LayoutLoader' not found in D:\personal\proj\renovate\application\Bootstrap.php on line 33 Kindly let me know, how can i come out from this issue. I am beginner in Zend Framework. Thanks Nikhil

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • jQuery: Stop browser scrolling on event update beyond the fold?

    - by neezer
    I have several links at the bottom of my page that update content at the top of my page (more than a viewport away). Here's the gist of what the update looks like: $('#private-photo div').fadeOut(function() { $(this).html('<%= escape_javascript(image_tag current_user.private_photo.image.url(:profile)) %>'); }).fadeIn(); Basically it's just fading out the old content and fading in the new content. My problem is that when this happens, the browser window automatically scrolls up just far enough so that the bottom of the updated content (#private-photo div) appears at the top of the browser viewport. I do not want this to happen. I want the content to be updated (still fading in and out), but without the browser viewport realigning its focus. I want to keep the animation because if the user has a big enough screen, or if they are using a link closer to the top of the page, I still want them to see the animation. Any ideas about how to prevent the browser from scrolling as described? If not, any suggestions for workarounds? FYI, I have this same problem in Safari 4, Chrome (for Mac), & Firefox 3.5. EDIT: Here's the link that calls the update action, which is itself inside a Colorbox: $('a.edit-photo').colorbox({ title: function() { return 'Edit Photo in ' + $(this).attr('rel'); }, overlayClose: false, onComplete: function() { $('#edit-photo-modal').submit(function(e) { $('#photo_submit').after('<span id="saving">Saving...</span>'); e.preventDefault(); $.post($(this).attr('action'), $(this).serialize(), function() { $('#edit-photo-modal #saving').text('Saved!'); }, "script"); }); } }); The lightbox opens, presents a form fetched through an AJAX request, then (on submit) triggers the update action mentioned above. I had these links outside of the Colorbox in an earlier design revision, and they exhibited the same problem, so I've ruled out Colorbox itself as a cause. If you need anymore info, let me know!

    Read the article

  • Change the content of a <style> element through JavaScript

    - by paercebal
    The Problem I have the following code: <html> <head> <style id="ID_Style"> .myStyle { color : #FF0000 ; } </style> </head> <body> <p class="myStyle"> Hello World ! </p> </body> </html> And I want to modify the contents of <style> through JavaScript. The Expected Solution The first solution was to use the innerHTML property of the style element (retrieved through its id), but while it works on Firefox, it fails on Internet Explorer 7. So, I used pure DOM methods, that is, creating an element called style, a text node with the desired content, and append the text node as a child of the style node, etc. It fails, too. According to MSDN, the <style> element has an innerHTML property, and according to W3C, the <style> element is a HTMLStyleElement, which derives from HTMLElement, deriving from Element deriving from Node, which has the appendChild method. It seems to behave as if the content of a <style> element was readonly on Internet Explorer. The Question So the question is: Is there a way to modify the content of a <style> element on Internet Explorer? While the current problem is with IE7, a cross-browser solution would be cool, if possible. Appendix Sources: Style Element (MSDN): http://msdn.microsoft.com/en-us/library/ms535898.aspx HTMLStyleElement (W3C): http://www.w3.org/TR/2003/REC-DOM-Level-2-HTML-20030109/html.html#ID-16428977 Complete Test Code You can use this test code if you want to reproduce your problem: <html> <head> <style id="ID_Style"> .myStyle { color : #FF0000 ; } </style> <script> function replaceStyleViaDOM(p_strContent) { var oOld = document.getElementById("ID_Style") ; var oParent = oOld.parentNode ; oParent.removeChild(oOld) ; var oNew = document.createElement("style") ; oParent.appendChild(oNew) ; oNew.setAttribute("id", "ID_Style") ; var oText = document.createTextNode(p_strContent) ; oNew.appendChild(oText) ; } function replaceStyleViaInnerHTML(p_strContent) { document.getElementById("ID_Style").innerHTML = p_strContent ; } </script> <script> function setRedViaDOM() { replaceStyleViaDOM("\n.myStyle { color : #FF0000 ; }\n") } function setRedViaInnerHTML() { replaceStyleViaInnerHTML("\n.myStyle { color : #FF0000 ; }\n") } function setBlueViaDOM() { replaceStyleViaDOM("\n.myStyle { color : #0000FF ; }\n") } function setBlueViaInnerHTML() { replaceStyleViaInnerHTML("\n.myStyle { color : #0000FF ; }\n") } function alertStyle() { alert("*******************\n" + document.getElementById("ID_Style").innerHTML + "\n*******************") ; } </script> </head> <body> <div> <button type="button" onclick="alertStyle()">alert Style</button> <br /> <button type="button" onclick="setRedViaDOM()">set Red via DOM</button> <button type="button" onclick="setRedViaDOM()">set Red via InnerHTML</button> <br /> <button type="button" onclick="setBlueViaDOM()">set Blue via DOM</button> <button type="button" onclick="setBlueViaInnerHTML()">set Blue via InnerHTML</button> </div> <p class="myStyle"> Hello World ! </p> </body> </html> Thanks !

    Read the article

  • How do I bind a jQuery Tools overlay event to an existing overlay?

    - by Paul
    Say when the page loads, this code runs: jQuery(document).ready(function($){ $('#overlay').overlay( api: true ); }); How would I bind an event to it? I've tried: $('#overlay').onBeforeLoad( function(){ alert('Hi'); }); $('#overlay').bind( 'onBeforeLoad', function(){ alert('Hi'); }); var api = $('#overlay').data('overlay'); api.onBeforeLoad(function(){ alert('Hi') }); When I do: alert(api.getContent().attr('id')); An alert pops up with '#overlay' inside. When the overlay is open and I run: alert(api.isOpened()); An alert pops up with 'false' inside. Thanks in advance.

    Read the article

  • emacs windows, distribute the width through the frame

    - by Gauthier
    I used once a very nice emacs function that set all my windows (emacs windows, not frames) width evenly. If you open emacs and do C-x 3 twice in a row, you get three vertical windows. Then running the function I am looking for makes the width of these windows the same. I can't for the life of me find this function again. Wouldn't someone help me to: find the name of the function give me the keyboard shortcut if any tell me what I should have done to find the answer by myself Thanks!

    Read the article

  • Very basic Javascript constructors problem

    - by misha-moroshko
    Hi, In the following JavaScript code main() is called. My question is why the second constructor is called rather than the first one ? What am I missing here ? Thanks !! function AllInputs() { alert("cons 1"); this.radioInputs = []; alert(this); } function AllInputs(radioElement) { alert("cons 2"); this.radioInputs = [radioElement]; alert(this); } AllInputs.prototype.toString = function() { return "[object AllInputs: radioInputs: " + this.radioInputs.length + "]"; } function main() { var result = new AllInputs(); }

    Read the article

  • jQuery: Use of undefined constant data assumed 'data'

    - by morpheous
    I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

    Read the article

  • modify this code .. please help me?

    - by Sam
    i wana modify this code from static choices to dynamic this for 3 choices var PollhttpObject=null; function DoVote() {if(document.getElementById('PollRadio1').checke d)DoVote_Submit(1);else if(document.getElementById('PollRadio2').checked)DoVote_Submit(2);else if(document.getElementById('PollRadio3').checked)DoVote_Submit(3);else alert('?????: ?????? ?????? ??? ?????????? ??????? ?? ????? ??? ?? ???????');return false;} function DisbalePoll(TheCase) {document.getElementById('VoteBttn').onclick=function(){alert('!?????? ??? ?? ??????? ??????');} document.getElementById('PollRadio1').disabled='true';document.getElementById('PollRadio2').disabled='true';document.getElementById('PollRadio3').disabled='true';if(TheCase=='EXPIRED') {document.getElementById('VoteBttn').src='images/design/VoteBttn_OFF.jpg';document.getElementById('ResultBttn').src='images/design/ResultsBttn_OFF.jpg';document.getElementById('VoteBttn').onclick='';document.getElementById('ResultBttn').onclick='';document.getElementById('ResultBttn').style.cursor='';document.getElementById('VoteBttn').style.cursor='';}} function DoVote_Submit(VoteID) {if(VoteID!=0)DisbalePoll();try{PollhttpObject=getHTTPObject();if(PollhttpObject!=null) {PollhttpObject.onreadystatechange=PollOutput;PollhttpObject.open("GET","Ajax.aspx?ACTION=POLL&VOTEID="+ VoteID+"&RND="+ Math.floor(Math.random()*10001),true);PollhttpObject.send(null);}} catch(e){} return false;} function PollOutput(){if(PollhttpObject.readyState==4) {var SearchResult=PollhttpObject.responseText;document.getElementById('PollProgress').style.display='none';document.getElementById('PollFormDiv').style.display='block';if(SearchResult.length=2&&SearchResult.substr(0,2)=='OK') {var ReturnedValue=SearchResult.split("#");document.getElementById('PollBar1').style.width=0+'px';document.getElementById('PollBar2').style.width=0+'px';document.getElementById('PollBar3').style.width=0+'px';document.getElementById('PollRate1').innerHTML="0 (0%)";document.getElementById('PollRate2').innerHTML="0 (0%)";document.getElementById('PollRate3').innerHTML="0 (0%)";window.setTimeout('DrawPollBars(0, '+ ReturnedValue[1]+', 0, '+ ReturnedValue[2]+', 0, '+ ReturnedValue[3]+')',150);} else if(SearchResult.length=2&&SearchResult.substr(0,2)=='NO') {alert("?????: ??? ??? ???????? ?????");}} else {document.getElementById('PollProgress').style.display='block';document.getElementById('PollFormDiv').style.display='none';}} function DrawPollBars(Bar1Var,Bar1Width,Bar2Var,Bar2Width,Bar3Var,Bar3Width) {var TotalVotes=parseInt(Bar1Width)+parseInt(Bar2Width)+parseInt(Bar3Width);var IncVal=parseFloat(TotalVotes/10);var NewBar1Width=0;var NewBar2Width=0;var NewBar3Width=0;var Bar1NextVar;var Bar2NextVar;var Bar3NextVar;if(parseInt(parseInt(Bar1Var)*200/TotalVotes)0)NewBar1Width=parseInt(Bar1Var)*200/TotalVotes;else if(Bar1Var0)NewBar1Width=1;else NewBar1Width=0;if(parseInt(parseInt(Bar2Var)*200/TotalVotes)0)NewBar2Width=parseInt(Bar2Var)*200/TotalVotes;else if(Bar2Var0)NewBar2Width=1;else NewBar2Width=0;if(parseInt(parseInt(Bar3Var)*200/TotalVotes)0)NewBar3Width=parseInt(Bar3Var)*200/TotalVotes;else if(Bar3Var0)NewBar3Width=1;else NewBar3Width=0;document.getElementById('PollBar1').style.width=NewBar1Width+'px';document.getElementById('PollBar2').style.width=NewBar2Width+'px';document.getElementById('PollBar3').style.width=NewBar3Width+'px';document.getElementById('PollRate1').innerHTML=parseFloat(Bar1Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar1Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate2').innerHTML=parseFloat(Bar2Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar2Var)/TotalVotes*100).toFixed(1)+"%)";document.getElementById('PollRate3').innerHTML=parseFloat(Bar3Var).toFixed(0)+" ("+ parseFloat(parseFloat(Bar3Var)/TotalVotes*100).toFixed(1)+"%)";if(Bar1Var!=Bar1Width||Bar2Var!=Bar2Width||Bar3Var!=Bar3Width) {if(parseFloat(Bar1Var)+IncVal<=parseInt(Bar1Width))Bar1NextVar=parseFloat(Bar1Var)+IncVal;else Bar1NextVar=Bar1Width;if(parseFloat(Bar2Var)+IncVal<=parseInt(Bar2Width))Bar2NextVar=parseFloat(Bar2Var)+IncVal;else Bar2NextVar=Bar2Width;if(parseFloat(Bar3Var)+IncVal<=parseInt(Bar3Width))Bar3NextVar=parseFloat(Bar3Var)+IncVal;else Bar3NextVar=Bar3Width;window.setTimeout('DrawPollBars('+ Bar1NextVar+', '+ Bar1Width+', '+ Bar2NextVar+', '+ Bar2Width+', '+ Bar3NextVar+', '+ Bar3Width+')',80); }}

    Read the article

  • C puzzle: Output of printf should be '5' always

    - by pragadheesh
    Hi, I found this puzzle in a C aptitude paper. void change() { //write something in this function so that output of printf in main function //should always give 5.you can't change the main function } int main() { int i = 5; change(); i = 10; printf("%d", i); return 0; } Any solutions.?

    Read the article

  • Problem with jQuery's fade in/out in Firefox

    - by GaVrA
    I already asked here with no luck, but feel free to read it: http://groups.google.com/group/jquery-en/browse%5Fthread/thread/fdf7a584b30d4bb9 Hmm check out my site: http://www.crtaci.info/ on top-right position i have search field. When you move your mouse over there small text shows up that says: Napredna pretraga Now, for some reason those letters change color to like yellow for very short period of time in ff 3.5 and to some strange color in safari 4.0.2 for win. In ie8, opera and chrome it works just the way it should, white letters stay white during the animation. Any sugestions? here is function that do this job ;) $('#header_search').hover(function() { $('#naprednaPretraga').stop({clearQueue:true}).show().animate({"opacity" : 1},500); }, function(){ $('#naprednaPretraga').stop({clearQueue:true}).animate({"opacity" : 0},500,function() { $('#naprednaPretraga').hide(); }); });

    Read the article

  • Dealing with multiple Javascript IF statements.

    - by Joey
    Is it possible to put multiple IF statements in Javascript? If so, I'm having a fair amount of trouble with the statement below. I was wondering if you can put another IF statement in between if (data == 'valid') AND else? I want to add another if data =='concept') between the two. if (data == 'valid') { $("#file").slideUp(function () { $("#file").before('<div class="approvedMessage">WIN WIN WIN!</div>'); setTimeout(ApprovedProof, 5000); }); function ApprovedProof() { $("#file").slideDown(); $('.approvedMessage').fadeOut(); } } else { $("#file").slideUp(function () { $("#file").before('<div class="deniedMessage">NO NO NO!</div>'); setTimeout(DeniedProof, 5000); }); function DeniedProof() { $("#file").slideDown(); $('.deniedMessage').fadeOut(); } }

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • How to convert this jquery code into noconflict

    - by metal-gear-solid
    will we have to replace every $ with jquery? $(document).ready(function() { $('.tabs a').click(function(){ switch_tabs($(this)); }); switch_tabs($('.defaulttab')); }); function switch_tabs(obj) { $('.tab-content').hide(); $('.tabs a').removeClass("selected"); var id = obj.attr("rel"); $('#'+id).show(); obj.addClass("selected"); }

    Read the article

  • This regx does not work only in Chrome

    - by Deeptechtons
    Hi i just put up a validation function in jScript to validate filename in fileupload control[input type file]. The function seems to work fine in FF and sometimes in ie but never in Chrome. Basically the function tests if File name is atleast 1 char upto 25 characters long.Contains only valid characters,numbers [no spaces] and are of file types in the list. Could you throw some light on this function validate(Uploadelem) { var objRgx = new RegExp(/^[\w]{1,25}\.*\.(jpg|gif|png|jpeg|doc|docx|pdf|txt|rtf)$/); objRgx.ignoreCase = true; if (objRgx.test(Uploadelem.value)) { document.getElementById('moreUploadsLink').style.display = 'block'; } else { document.getElementById('moreUploadsLink').style.display = 'none'; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can I interrupt javascript code and then continue on a keystroke?

    - by Brian Ramsay
    I am porting an old game from C to Javascript. I have run into an issue with display code where I would like to have the main game code call display methods without having to worry about how those status messages are displayed. In the original code, if the message is too long, the program just waits for the player to toggle through the messages with the spacebar and then continues. This doesn't work in javascript, because while I wait for an event, all of the other program code continues. I had thought to use a callback so that further code can execute when the player hits the designated key, but I can't see how that will be viable with a lot of calls to display.update(msg) scattered throughout the code. Can I architect things differently so the event-based, asynchronous model works, or is there some other solution that would allow me to implement a more traditional event loop? Am I making sense? Example: // this is what the original code does, but obviously doesn't work in Javascript display = { update : function(msg) { // if msg is too long // wait for user input // ok, we've got input, continue } }; // this is more javascript-y... display = { update : function(msg, when_finished) { // show part of the message $(document).addEvent('keydown', function(e) { // display the rest of the message when_finished(); }); } }; // but makes for amazingly nasty game code do_something(param, function() { // in case do_something calls display I have to // provide a callback for everything afterwards // this happens next, but what if do_the_next_thing needs to call display? // I have to wait again do_the_next_thing(param, function() { // now I have to do this again, ad infinitum } }

    Read the article

  • Showing a loading spinner only if the data has not been cached.

    - by Aaron Mc Adam
    Hi guys, Currently, my code shows a loading spinner gif, returns the data and caches it. However, once the data has been cached, there is a flicker of the loading gif for a split second before the data gets loaded in. It's distracting and I'd like to get rid of it. I think I'm using the wrong method in the beforeSend function here: $.ajax({ type : "GET", cache : false, url : "book_data.php", data : { keywords : keywords, page : page }, beforeSend : function() { $('.jPag-pages li:not(.cached)').each(function (i) { $('#searchResults').html('<p id="loader">Loading...<img src="../assets/images/ajax-loader.gif" alt="Loading..." /></p>'); }); }, success : function(data) { $('.jPag-current').parent().addClass('cached'); $('#searchResults').replaceWith($(data).find('#searchResults')).find('table.sortable tbody tr:odd').addClass('odd'); detailPage(); selectForm(); } });

    Read the article

  • Can I find out the return value before returning while debugging in Visual Studio

    - by doekman
    Take the following function: DataTable go() { return someTableAdapter.getSomeData(); } When I set a breakpoint in this function, is there a possibility to inspect the returned value? The "go" function is directly coupled to a datagrid in an aspx page. The only way to inspect the returned datatable, is to use a temporary variable... However, that's a bit inconvenient. Isn't there another way?

    Read the article

  • Link User32 with gcc

    - by Tim Cooper
    I have a C program which has a function call that is defined in windows.h (which I have included), however, when I try and compile it with gcc, I get the error: warning: implicit declaration of function `LockWorkStation' I looked at the MSDN documentation and I see that this function is the User32 library file, and I was wondering how I would go about linking that to my file.

    Read the article

  • pass data from popup to parent

    - by user522962
    I have a parent w/ a popup child. When parent loads, I have to call a function within the popup without showing the popup (thus, I load "pupLove" but don't include it in layout)....I then pass this data to the parent. When the user manually clicks another button to open the popup, the same function is called & data passed to the parent. However, I am not able to pass dg.length to the parent. I believe the root problem is that I am loading "pupLove" & thus the parents are getting confused.....I'm guessing if I get rid of "pupLove" I can pass the data correctly but will need to call the child's function at creationComplete of the parent....how do I do that? Here's my parent: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" backgroundColor="green" width="50%" height="100%" xmlns:local="*" > <fx:Script> <![CDATA[ import pup; import mx.managers.PopUpManager; public function showPup(evt:MouseEvent):void { var ttlWndw:pup = PopUpManager.createPopUp(this, pup, true) as pup; PopUpManager.centerPopUp(ttlWndw); } ]]> </fx:Script> <mx:VBox> <local:pup id="pupLove" visible="false" includeInLayout="false" /> <s:Button click="showPup(event);" label="launch Pup" /> <mx:Text id="Ptest" color="black" text="from Parent:{pupLove.dg.length}" /> </mx:VBox> </s:Application> And a popup child called 'pup.mxml': <?xml version="1.0" encoding="utf-8"?> <s:Group xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" width="400" height="300"> <fx:Script> <![CDATA[ public function init():void{ // send php call } import mx.events.CloseEvent; import mx.managers.PopUpManager; private function removePup(evt:Event):void { PopUpManager.removePopUp(this); } ]]> </fx:Script> <fx:Declarations> <s:ArrayCollection id="dg"> </s:ArrayCollection> </fx:Declarations> <s:TitleWindow width="100%" height="100%" close="removePup(event)"> <mx:VBox> <mx:Text id="test" color="red" text="from Child:{dg.length}" /> <s:Button label="add Items" click="dg.addItem({id:'cat'})" /> </mx:VBox> </s:TitleWindow> </s:Group> UPDATE: I guess my question can be more easily stated as: "is there a way to call a child's function from the parent without actually loading the child?"

    Read the article

  • Publish to Facebook Stream in as3

    - by Kid Adiran
    Hi, I am trying to publish to a users stream when they click a share button in my flash app that i have living in a tab on a fan fan. I basically have my swf embedded on a page that has a java script function that calls the facebook share dialogue. Here is what i got so far: // flash embedd <fb:fbjs-bridge/> // share function <script> function publishfeed() { var attachment = {'media':[{'type':'image','src':'http://bit.ly/AJTnf','href':'http://bit.ly/hifZk'}]}; Facebook.streamPublish('', attachment); } In my flash file, I try using this code to get it to pull the javascript funtion, but no luck. function jspopupWindow(event:MouseEvent):void { var request:URLRequest = new URLRequest("javascript:publishfeed()"); navigateToURL(request,"_blank"); } share_btn.addEventListener(MouseEvent.CLICK, jspopupWindow); Can anyone help me, what am i missing? thanks a

    Read the article

  • Problem loading scripts from Ajax Response

    - by konathamrajesh
    The problem is I am using get_info() to make a ajax call to Result.lasso and paste the response in div with id 'test'.I am unable to use the sendForm() function from the page where i am calling the get_info(). I have also tried using different versions of jQuery 1.1.1.3 is working fine.But i am facing the problem while using higher versions of jquery. The error with higher versions is as follows missing } in XML expression [Break on this error] alert('hi');\n test.lasso (line 3) sendForm is not defined [Break on this error] sendForm(); get_info() function definition <script src="http://ajax.googleapis.com/ajax/libs/jquery/1.2.6/jquery.min.js" type="text/javascript"></script> <SCRIPT> function get_info() { $.ajax({url: "Result.lasso", context: document.body, success: function(response){ document.getElementById('test').innerHTML = response ;},dataType:"script"}); } </SCRIPT> The code in Result.lasso is as follows [Content_Type: 'text/html; charset=UTF-8'] <script type="text/javascript"> function sendForm() { alert('hi'); } </script> [Date] form name= "abc" method = "get" action = "abcd.lasso"> input type ="text" name = "element1"/> input type = "button" value="Click" onClick = "javascript: sendForm();"/> </form> Please help me out in resolving this problem Thanks, Rajesh Konatham

    Read the article

< Previous Page | 328 329 330 331 332 333 334 335 336 337 338 339  | Next Page >