Search Results

Search found 38817 results on 1553 pages for 'inline function'.

Page 330/1553 | < Previous Page | 326 327 328 329 330 331 332 333 334 335 336 337  | Next Page >

  • Strategies for Error Handling in .NET Web Services

    - by Jarrod
    I have a fairly substantial library of web services built in .NET that I use as a data model for our company web sites. In most .NET applications I use the Global ASAX file for profiling, logging, and creating bug reports for all exceptions thrown by the application. Global ASAX isn't available for web services so I'm curious as to what other strategies people have come up with to work around this limitation. Currently I just do something along these lines: <WebMethod()> _ Public Function MyServiceMethod(ByVal code As Integer) As String Try Return processCode(code) Catch ex As Exception CustomExHandler(ex) 'call a custom function every time to log exceptions Return errorObject End Try End Function Anybody have a better way of doing things besides calling a function inside the Catch?

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Return value from ajax call?

    - by Dan
    Hi, I'm making a basic ajax function in jquery which echoes the number of rows found in a MySQL Query. function checkEventIDClass(id) { var params = 'method=checkEventIDClash&table=test&id=' + id; $.ajax({ type: "POST", url: "ajax.php", data: params, success: function(result){ return result; } }); } Is it possible to use this returned value in another function? I have tried but only get undefined values. In this situation, it will be acceptable to use synchronous calls. Any advice appreciated. Thanks

    Read the article

  • Ajax, Callback, postback and Sys.WebForms.PageRequestManager.getInstance().add_beginRequest

    - by user338262
    Hi, I have a user control which encapsulates a NumericUpDownExtender. This UserControl implements the interface ICallbackEventHandler, because I want that when a user changes the value of the textbox associated a custom event to be raised in the server. By the other hand each time an async postback is done I shoe a message of loading and disable the whole screen. This works perfect when something is changed in for example an UpdatePanel through this lines of code: Sys.WebForms.PageRequestManager.getInstance().add_beginRequest( function (sender, args) { var modalPopupBehavior = $find('programmaticSavingLoadingModalPopupBehavior'); modalPopupBehavior.show(); } ); The UserControl is placed inside a detailsview which is inside an UpdatePanel in an aspx. When the custom event is raised I want another textbox in the aspx to change its value. So far, When I click on the UpDownExtender, it goes correctly to the server and raises the custom event, and the new value of the textbox is assigned in the server. but it is not changed in the browser. I suspect that the problem is the callback, since I have the same architecture for a UserControl with an AutoCompleteExtender which implement IPostbackEventHandler and it works. Any clues how can I solve this here to make the UpDownNumericExtender user control to work like the AutComplete one? This is the code of the user control and the parent: using System; using System.Web.UI; using System.ComponentModel; using System.Text; namespace Corp.UserControls { [Themeable(true)] public partial class CustomNumericUpDown : CorpNumericUpDown, ICallbackEventHandler { protected void Page_PreRender(object sender, EventArgs e) { if (!Page.IsPostBack) { currentInstanceNumber = CorpAjaxControlToolkitUserControl.getNextInstanceNumber(); } registerControl(this.HFNumericUpDown.ClientID, currentInstanceNumber); string strCallServer = "NumericUpDownCallServer" + currentInstanceNumber.ToString(); // If this function is not written the callback to get the disponibilidadCliente doesn't work if (!Page.ClientScript.IsClientScriptBlockRegistered("ReceiveServerDataNumericUpDown")) { StringBuilder str = new StringBuilder(); str.Append("function ReceiveServerDataNumericUpDown(arg, context) {}").AppendLine(); Page.ClientScript.RegisterClientScriptBlock(typeof(CorpNumericUpDown), "ReceiveServerDataNumericUpDown", str.ToString(), true); } nudeNumericUpDownExtender.BehaviorID = "NumericUpDownEx" + currentInstanceNumber.ToString(); ClientScriptManager cm = Page.ClientScript; String cbReference = cm.GetCallbackEventReference(this, "arg", "ReceiveServerDataNumericUpDown", ""); String callbackScript = "function " + strCallServer + "(arg, context)" + Environment.NewLine + "{" + Environment.NewLine + cbReference + ";" + Environment.NewLine + "}" + Environment.NewLine; cm.RegisterClientScriptBlock(typeof(CustomNumericUpDown), strCallServer, callbackScript, true); base.Page_PreRender(sender,e); } [System.ComponentModel.Browsable(true)] [System.ComponentModel.Bindable(true)] public Int64 Value { get { return (string.IsNullOrEmpty(HFNumericUpDown.Value) ? Int64.Parse("1") : Int64.Parse(HFNumericUpDown.Value)); } set { HFNumericUpDown.Value = value.ToString(); //txtAutoCompleteCliente_AutoCompleteExtender.ContextKey = value.ToString(); // TODO: Change the text of the textbox } } [System.ComponentModel.Browsable(true)] [System.ComponentModel.Bindable(true)] [Description("The text of the numeric up down")] public string Text { get { return txtNumericUpDown.Text; } set { txtNumericUpDown.Text = value; } } public delegate void NumericUpDownChangedHandler(object sender, NumericUpDownChangedArgs e); public event NumericUpDownChangedHandler numericUpDownEvent; [System.ComponentModel.Browsable(true)] [System.ComponentModel.Bindable(true)] [System.ComponentModel.Description("Raised after the number has been increased or decreased")] protected virtual void OnNumericUpDownEvent(object sender, NumericUpDownChangedArgs e) { if (numericUpDownEvent != null) //check to see if anyone has attached to the event numericUpDownEvent(this, e); } #region ICallbackEventHandler Members public string GetCallbackResult() { return "";//throw new NotImplementedException(); } public void RaiseCallbackEvent(string eventArgument) { NumericUpDownChangedArgs nudca = new NumericUpDownChangedArgs(long.Parse(eventArgument)); OnNumericUpDownEvent(this, nudca); } #endregion } /// <summary> /// Class that adds the prestamoList to the event /// </summary> public class NumericUpDownChangedArgs : System.EventArgs { /// <summary> /// The current selected value. /// </summary> public long Value { get; private set; } public NumericUpDownChangedArgs(long value) { Value = value; } } } using System; using System.Collections.Generic; using System.Text; namespace Corp { /// <summary> /// Summary description for CorpAjaxControlToolkitUserControl /// </summary> public class CorpNumericUpDown : CorpAjaxControlToolkitUserControl { private Int16 _currentInstanceNumber; // This variable hold the instanceNumber assignated at first place. public short currentInstanceNumber { get { return _currentInstanceNumber; } set { _currentInstanceNumber = value; } } protected void Page_PreRender(object sender, EventArgs e) { const string strOnChange = "OnChange"; const string strCallServer = "NumericUpDownCallServer"; StringBuilder str = new StringBuilder(); foreach (KeyValuePair<String, Int16> control in controlsToRegister) { str.Append("function ").Append(strOnChange + control.Value).Append("(sender, eventArgs) ").AppendLine(); str.Append("{").AppendLine(); str.Append(" if (sender) {").AppendLine(); str.Append(" var hfield = document.getElementById('").Append(control.Key).Append("');").AppendLine(); str.Append(" if (hfield.value != eventArgs) {").AppendLine(); str.Append(" hfield.value = eventArgs;").AppendLine(); str.Append(" ").Append(strCallServer + control.Value).Append("(eventArgs, eventArgs);").AppendLine(); str.Append(" }").AppendLine(); str.Append(" }").AppendLine(); str.Append("}").AppendLine(); Page.ClientScript.RegisterClientScriptBlock(typeof(CorpNumericUpDown), Guid.NewGuid().ToString(), str.ToString(), true); } str = new StringBuilder(); foreach (KeyValuePair<String, Int16> control in controlsToRegister) { str.Append(" funcsPageLoad[funcsPageLoad.length] = function() { $find('NumericUpDownEx" + control.Value + "').add_currentChanged(").Append(strOnChange + control.Value).Append(");};").AppendLine(); str.Append(" funcsPageUnLoad[funcsPageUnLoad.length] = function() { $find('NumericUpDownEx" + control.Value + "').remove_currentChanged(").Append(strOnChange + control.Value).Append(");};").AppendLine(); } Page.ClientScript.RegisterClientScriptBlock(typeof(CorpNumericUpDown), Guid.NewGuid().ToString(), str.ToString(), true); } } } and to create the loading view I use this: //The beginRequest event is raised before the processing of an asynchronous postback starts and the postback is sent to the server. You can use this event to call custom script to set a request header or to start an animation that notifies the user that the postback is being processed. Sys.WebForms.PageRequestManager.getInstance().add_beginRequest( function (sender, args) { var modalPopupBehavior = $find('programmaticSavingLoadingModalPopupBehavior'); modalPopupBehavior.show(); } ); //The endRequest event is raised after an asynchronous postback is finished and control has been returned to the browser. You can use this event to provide a notification to users or to log errors. Sys.WebForms.PageRequestManager.getInstance().add_endRequest( function (sender, arg) { var modalPopupBehavior = $find('programmaticSavingLoadingModalPopupBehavior'); modalPopupBehavior.hide(); } ); Thanks in advance! Daniel.

    Read the article

  • Creating a form dynamically

    - by Nathan
    Hi, I use a search button that creates a form dynamically at the server side and returns it with Jquery syntax. After I fill-up the form and click on submit button, there is another .submit() Jquery function that suppose to be called to validate input before data is sent to the server. But, for some reason, this function is never called, and the data is request is sent. In more details: This is the form that the serach button creates dynamically at the server side and "prints" to html page with Jquery: <form action=... name="stockbuyform" class="stockbuyform" method="post"> <input type=text value="Insert purchasing amount"> <input type="submit" value="Click to purchase"> </form> And here is the .submit() function : $(".stockbuyform").submit(function() { alert("Need to validate purchasing details"); } But whaen I click on purchase button, the .submit() function is never called. Does it mean that I can't use another Jquery call with the answer I got in the first call?

    Read the article

  • How to store result of drag and drop as a image

    - by Jimmy
    I want to take the screenshot of the result of drag and drop, but I don't know how to do. Actually, I found 2 javascript and using HTML5 such as html2canvas and canvas2image. I am now combining them together, but it's still meet some problem with the canvas2image. Please help me solve this problem if you have same experience, thank you a lot. Please help me, I've been stock here for days. Drag and drop code. <script> $(function() { $( "#draggable" ).draggable(); $( "#draggable2" ).draggable(); $( "#droppable" ).droppable({ hoverClass: "ui-state-active", drop: function( event, ui ) { $( this ) .addClass( "ui-state-highlight" ) .find( "p" ) .html( "Dropped!" ); } }); }); </script> Image generation code <script> window.onload = function() { function convertCanvas(strType) { if (strType == "JPEG") var oImg = Canvas2Image.saveAsJPEG(oCanvas, true); if (!oImg) { alert("Sorry, this browser is not capable of saving " + strType + " files!"); return false; } oImg.id = "canvasimage"; oImg.style.border = oCanvas.style.border; oCanvas.parentNode.replaceChild(oImg, oCanvas); } function convertHtml(strType) { $('body').html2canvas(); var queue = html2canvas.Parse(); var canvas = html2canvas.Renderer(queue,{elements:{length:1}}); var img = canvas.toDataURL(); convertCanvas(strType); window.open(img); } document.getElementById("html2canvasbtn").onclick = function() { convertHtml("JPEG"); } } </script> HTML code <body> <h3>Picture:</h3> <div id="draggable"> <img src='http://1.gravatar.com/avatar/1ea64135b09e00ab80fa7596fafbd340? s=50&d=identicon&r=R'> </div> <div id="draggable2"> <img src='http://0.gravatar.com/avatar/2647a7d4b4a7052d66d524701432273b?s=50&d=identicon&r=G'> </div> <div id="dCanvas"> <canvas id="droppable" width="500" height="500" style="border: 2px solid gray" class="ui-widget-header" /> </div> <input type="button" id="bGenImage" value="Generate Image" /> <div id="dOutput"></div> </body>

    Read the article

  • javascript binding

    - by Michael
    MyObj = { ajax: null, init: function() { this.ajax = Cc["@mozilla.org/xmlextras/xmlhttprequest;1"].createInstance(); this.ajax.onload = function() { return function() {this.onload.apply(this, [null]);} }; }, onload: function () { Reader.log("I really hope I can use `this.ajax` here"); } } isn't it correct way to bind onload to MyObj? For some reason onload never called. However if I avoid binding and just put this.ajax.onload = this.onload then onload invoked. How to get binding work?

    Read the article

  • Help with jQuery issue

    - by Espen Arnoy
    I have a simple page with a list if "items". I am allowing users to vote on these items, but I only want to allow the user to vote one per. item. Therefore i have made a jQuery script that adds a class to the items the user has voted on: if(! $(this).find(".item span").hasClass("voted")) { $(".item").hover(function() { $(this).find(".ratingbar").hide(); $(this).find(".votebar").show(); }, function() { $(this).find(".votebar").hide(); $(this).find(".ratingbar").show(); }); }; This is the script that prevents the user from voting again on the same item. $(".votebutton").click(function() { $("div#"+offerid).find(".item").addClass("voted"); } My problem is that this doesn´t work. When hovering an item, the hover function still runs even though the second script successfully added the class "voted" to the html. Why can this be?

    Read the article

  • jQuery Tablesorter - column not sorting alphabetically

    - by McGirl
    I'm not sure what's going wrong here. This is the page: http://www.utexas.edu/ssw/cswr/projects/project-list/ The first column sorts, but it isn't returning data in the correct order (alphabetical). The table itself is being generated by a custom PHP function that pulls info from a WordPress database. I thought that might be the issue, but as you can see the fourth column (End Date) sorts correctly. I also thought it might be the links in the first column that were messing things up, but adding the text-extraction code from this page broke the sorting altogether. This is the jQuery code I'm current using to call Tablesorter: <script type="text/javascript" id="js"> jQuery(document).ready(function($) { $(document).ready(function() { // call the tablesorter plugin, the magic happens in the markup $("#projectTable").tablesorter({ // pass the headers argument and assing a object //debug: true, //sortList: [[0,0]], headers: { 0: { // set the column to sort as text sorter: 'text', }, // assign the secound column (we start counting zero) 1: { // disable it by setting the property sorter to false sorter: false, }, // assign the third column (we start counting zero) 2: { // disable it by setting the property sorter to false sorter: false }, 3: { sorter:'digit' } } }); // Works only with plugin modification $("#projectTable").bind("sortStart",function(e) { if( $(e.target).hasClass('header') ) { $("#overlay").show(); } }).bind("sortEnd",function(e) { if( $(e.target).hasClass('header') ) { $("#overlay").hide(); } }); }); }); </script> Thanks for your help!

    Read the article

  • How do you make javascript code execute *in order*

    - by Ed
    Okay, so I appreciate that Javascript is not C# or PHP, but I keep coming back to an issue in Javascript - not with JS itself but my use of it. I have a function: function updateStatuses(){ showLoader() //show the 'loader.gif' in the UI updateStatus('cron1'); //performs an ajax request to get the status of something updateStatus('cron2'); updateStatus('cron3'); updateStatus('cronEmail'); updateStatus('cronHourly'); updateStatus('cronDaily'); hideLoader(); //hide the 'loader.gif' in the UI } Thing is, owing to Javascript's burning desire to jump ahead in the code, the loader never appears because the 'hideLoader' function runs straight after. How can I fix this? Or in other words, how can I make a javascript function execute in the order I write it on the page...

    Read the article

  • Defaults for null values

    - by OldFart
    Working on a Powershell script I had several places where I wanted A unless it was null, else B. Essentially the ?? operator in C#. I ended up writing the function shown below, but I can't help but think there is a built-in way to do this. Is there a better, built-in, way? function Get-ValueOrDefault() { foreach ($value in $args) { if ($value -ne $null) { return $value } } } I think this works better: function Get-ValueOrDefault() { $args | select -first 1 }

    Read the article

  • Binding jQuery UI plugin after $.load

    - by TomWilsonFL
    I have a function that attaches the jQuery UI DatePicker (with my options) to a passed jQuery object: function bindDatepicker($obj) { if ($obj == null) $obj = $("input.date"); $obj.datepicker( { appendText: '(yyyy-mm-dd)', autoSize: true, changeMonth: true, changeYear: true, closeText: 'Done', dateFormat: 'yy-mm-dd', defaultDate: '+1m', minDate: +1, numberOfMonths: 2 } ); } I call this at the beginning of every page to bind it to input elements: $(function() { bindDatepicker($("input.date")); }); This works fine. My problem comes in when I load form elements using $.load(). I cannot attach the DatePicker to any of the loaded elements. For example: $("#id").load("urlToLoad", function() { bindDatepicker($("input.date")); }); Loads the form elements into a div just fine, but will not attach the DatePicker. Why is this? I am stumped. :( Thanks, Tom

    Read the article

  • Iphone - UIView not displayed

    - by Raphael Pinto
    Hi, I have a strange problem with a UIView : I want to show an Activity Indicator View that I created with Interface Builder to indicate long running activity. In the viewDidLoad function of my principal viewController I init the ActivityIndicator View like this : - (void)viewDidLoad { [super viewDidLoad]; appDelegate = (MyAppDelegate *)[[UIApplication sharedApplication] delegate]; load = [[ActivityIndicatorViewController alloc] init]; ... When I push a button it call this IBAction : - (IBAction)LaunchButtonPressed{ // Show the Activity indicator view. [self.view addSubview:load.view]; // eavy work [self StartWorking]; // Hide the loading view. [load.view removeFromSuperview]; } In the StartWorking function, I ask a request to an internet serveur and parse the XML file that it return me. The problem is that if I Call my StartWorking function, the application do not start by showing the Activity Indicator view but with the StartWorking function. Whereas if I remove the call to StartWorking function, the view is shown. Is someone able to explain me why? :s

    Read the article

  • JQuery never reaches success or fail on aspx returning json.

    - by David
    Basicaly I have my aspx page doing <% Response.Clear(); Response.Write("{\"Success\": \"true\" }"); Response.End(); %> My JQuery code is function DoSubmit(r) { if (r == null || r.length == 0 || formdata == null || formdata.length == 0) return; for (i = 0; i < formdata.length; i++) { var fd = formdata[i]; r[fd.Name] = fd.Value; } r["ModSeq"] = tblDef.ModSeq; jQuery.ajax({ url: "NashcoUpdate.aspx" , succsess: doRow , error: DoSubmitError , complete: DoSubmitComplete , dataType: "json" , cache: false , data: r , type: "post" }) } When I call the DoSubmit() function every thing works but the doRow or DoSubmitError functions never get called only the DoSubmitComplete function. When I look at the response text in teh DoSubmitComple function it is {"Success": "true" } Every JSON tester I have tried says that this is valied JSON. What am I doing wrong here?

    Read the article

  • Why can't my program display this dialog box, while another program can?

    - by nonoitall
    I'm trying to write a wrapper for Winamp input plugins and have hit a bit of a snag. I'd like my wrapper to be able to display a plugin's configuration dialog, which is (or should be) achieved by calling the plugin's Config(HWND hwndParent) function. For most plugins, this works fine and my program is able to display the plugin's configuration dialog. However, 64th Note (a plugin for playing USF files) is giving me problems. Winamp can display its configuration dialog just fine, but whenever I try to display it from my wrapper, the dialog gets destroyed before it ever shows itself. Thankfully, 64th Note is open source, so I took a look at its innards to try and get an idea of what's going wrong. I've trimmed off the irrelevant bits and am left with this: Config function in the plugin (should show configuration dialog): void Config(HWND hwndParent) { DialogBox(slave, (const char *) IDD_CONFIG_WINDOW, NULL, configDlgProc); } (Slave is the plugin DLL's HINSTANCE handle.) The proc for the dialog is as follows (I have stripped out all the functionality, since it doesn't appear to have an influence on this problem): BOOL CALLBACK configDlgProc(HWND hDlg, UINT uMsg, WPARAM wParam, LPARAM lParam) { return 0; } The template for IDD_CONFIG_WINDOW is as follows: IDD_CONFIG_WINDOW DIALOGEX 0, 0, 269, 149 STYLE DS_SETFONT | DS_MODALFRAME | WS_POPUP | WS_CAPTION | WS_SYSMENU CAPTION "64th Note configuration" FONT 8, "MS Sans Serif", 0, 0, 0x0 BEGIN DEFPUSHBUTTON "OK",IDOK,212,38,50,14 CONTROL "Play Forever",IDC_NOLENGTH,"Button",BS_AUTORADIOBUTTON,7,7,55,8 CONTROL "Always Use Default Length",IDC_SETLEN,"Button",BS_AUTORADIOBUTTON,7,17,101,8 CONTROL "Default Length",IDC_DEFLEN,"Button",BS_AUTORADIOBUTTON,7,29,63,8 EDITTEXT IDC_DEFLENVAL,71,28,38,12,ES_AUTOHSCROLL EDITTEXT IDC_DEFFADEVAL,71,42,38,12,ES_AUTOHSCROLL CONTROL "Detect Silence",IDC_DETSIL,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,7,56,63,8 EDITTEXT IDC_DETSILVAL,71,56,38,12,ES_AUTOHSCROLL CONTROL "Slider2",IDC_PRISLIDER,"msctls_trackbar32",TBS_AUTOTICKS | WS_TABSTOP,74,90,108,11 EDITTEXT IDC_TITLEFMT,7,127,255,15,ES_AUTOHSCROLL CONTROL "Default to file name on missing field",IDC_FNONMISSINGTAG, "Button",BS_AUTOCHECKBOX | WS_TABSTOP,50,114,124,8 CONTROL "Use Recompiler CPU",IDC_RECOMPILER,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,7,83,8 CONTROL "Round Frequency",IDC_ROUNDFREQ,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,16,73,8 CONTROL "Seek Backwards",IDC_BACKWARDS,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,26,70,8 CONTROL "Fast Seek",IDC_FASTSEEK,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,35,48,8 CONTROL "RSP Sections",IDC_SECTIONS,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,45,60,8 CONTROL "Soft Amplify",IDC_SOFTAMP,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,54,53,8 CONTROL "Audio HLE",IDC_AUDIOHLE,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,63,50,8 CONTROL "Auto Audio HLE",IDC_AUTOAUDIOHLE,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,72,64,8 CONTROL "Display Errors",IDC_DISPERROR,"Button",BS_AUTOCHECKBOX | WS_TABSTOP,145,81,58,8 EDITTEXT IDC_RELVOL,211,104,28,12,ES_AUTOHSCROLL PUSHBUTTON "Cancel",IDCANCEL,212,54,50,14 PUSHBUTTON "Help",IDHELPBUTTON,212,71,50,14 LTEXT "Title format:",IDC_STATIC,7,113,38,8 LTEXT "seconds",IDC_STATIC,112,29,28,8 LTEXT "Default Fade",IDC_STATIC,19,43,42,8 LTEXT "seconds",IDC_STATIC,112,43,28,8 LTEXT "seconds",IDC_STATIC,112,57,28,8 CTEXT "CPU Thread Priority",IDC_STATIC,7,91,63,8 CTEXT "Look ma, I'm data!",IDC_CPUPRI,75,104,108,8 LTEXT "Relative Volume",IDC_STATIC,199,94,52,8 LTEXT "Fade Type",IDC_STATIC,7,75,35,8 COMBOBOX IDC_FADETYPE,45,72,87,74,CBS_DROPDOWNLIST | WS_TABSTOP END Naturally, without any substance in the proc function, the dialog doesn't have any functionality, but it still displays in Winamp when the Config function is invoked. However, it does not appear when I invoke it from my wrapper program. When I monitored the messages sent to the dialog in its proc function, I saw that WM_DESTROY and WM_NCDESTROY were sent within the first few messages, though I have no clue as to why. If I change the Config function so that it displays the plugin's About dialog instead of its configuration dialog, both Winamp and my wrapper will display the About dialog, which suggests that there is something unique to the configuration dialog template that's causing the problem. The modified Config function reads like so: void Config(HWND hwndParent) { DialogBox(slave, (const char *) IDD_ABOUTBOX, NULL, configDlgProc); } The template for the About dialog is as follows: IDD_ABOUTBOX DIALOGEX 0, 0, 152, 151 STYLE DS_SETFONT | DS_MODALFRAME | WS_POPUP | WS_CAPTION | WS_SYSMENU CAPTION "About 64th Note" FONT 8, "MS Sans Serif", 0, 0, 0x1 BEGIN LTEXT "64th Note v1.2 beta 3\nBased on Project 64 1.6 by Zilmar and Jabo\nAudio HLE by Azimer\nPSF concept and tagging by Neill Corlett\nPlayer by hcs, Josh W, dr0\nhttp://hcs64.com/usf",IDC_STATIC,7,94,138,50 CONTROL 110,IDC_STATIC,"Static",SS_BITMAP,26,7,95,86,WS_EX_DLGMODALFRAME END Like I said, my wrapper displays the About dialog just fine, as does Winamp. Why can Winamp display the Config dialog, while my wrapper cannot?

    Read the article

  • This regx does not work only in Chrome

    - by Deeptechtons
    Hi i just put up a validation function in jScript to validate filename in fileupload control[input type file]. The function seems to work fine in FF and sometimes in ie but never in Chrome. Basically the function tests if File name is atleast 1 char upto 25 characters long.Contains only valid characters,numbers [no spaces] and are of file types in the list. Could you throw some light on this function validate(Uploadelem) { var objRgx = new RegExp(/^[\w]{1,25}\.*\.(jpg|gif|png|jpeg|doc|docx|pdf|txt|rtf)$/); objRgx.ignoreCase = true; if (objRgx.test(Uploadelem.value)) { document.getElementById('moreUploadsLink').style.display = 'block'; } else { document.getElementById('moreUploadsLink').style.display = 'none'; } }

    Read the article

  • Changing the action of a form with javascript/jquery

    - by Micah
    I'm having an issue that is driving me crazy. I'm trying to modify the openid-selector to support facebook. I'm using RPXNow as my provider so it requires the form to be submitted to a different url than the standard. For example. RpxNow requires me to setup my form like this: <form action="https://wikipediamaze.rpxnow.com/openid/start?token_url=..."> This works for every provider except for facebook and myspace. Those require the form to be posted to a different url like this: <form action="https://wikipediamaze.rpxnow.com/facebook/start?token_url=..."> and <form action="https://wikipediamaze.rpxnow.com/myspace/start?token_url=..."> The open id selector has a bunch of buttons on the form each representing the openid providers. What I'm trying to do is detect when the facebook or myspace button is clicked and changed the action on the form before submitting. However it's not working. Here is my code. I've tried several variations all with the same "not supported" exception $("#openid_form").attr("action", form_url) document.forms[0].action = form_url Any suggestions? Update Here are more details on the code. I've ommitted some for brevity. The only thing i've done is added the facebook section to the "providers_large" object (which successfully adds the logo to the website), and instead of supply a url identifying the user, I'm creating a property called "form_url" which is what I want to set the action of my form to. If you look at the section title "Provider image click" you'll see where I'm checking for the presence of the property "form_url" and using jquery to change the action and submit the form. However when I step through the javascript in debug mode it tells me it's an ivalid operation. var providers_large = { google: { name: 'Google', url: 'https://www.google.com/accounts/o8/id' }, facebook: { name: 'Facebook', form_url: 'http://wikipediamaze.rpxnow.com/facebook/start?token_url=http://www.wikipediamaze.com/Accounts/Logon' }, }; var providers_small = { myopenid: { name: 'MyOpenID', label: 'Enter your MyOpenID username.', url: 'http://{username}.myopenid.com/' }, livejournal: { name: 'LiveJournal', label: 'Enter your Livejournal username.', url: 'http://{username}.livejournal.com/' }, flickr: { name: 'Flickr', label: 'Enter your Flickr username.', url: 'http://flickr.com/{username}/' }, technorati: { name: 'Technorati', label: 'Enter your Technorati username.', url: 'http://technorati.com/people/technorati/{username}/' }, wordpress: { name: 'Wordpress', label: 'Enter your Wordpress.com username.', url: 'http://{username}.wordpress.com/' }, blogger: { name: 'Blogger', label: 'Your Blogger account', url: 'http://{username}.blogspot.com/' }, verisign: { name: 'Verisign', label: 'Your Verisign username', url: 'http://{username}.pip.verisignlabs.com/' }, vidoop: { name: 'Vidoop', label: 'Your Vidoop username', url: 'http://{username}.myvidoop.com/' }, verisign: { name: 'Verisign', label: 'Your Verisign username', url: 'http://{username}.pip.verisignlabs.com/' }, claimid: { name: 'ClaimID', label: 'Your ClaimID username', url: 'http://claimid.com/{username}' } }; var providers = $.extend({}, providers_large, providers_small); var openid = { cookie_expires: 6*30, // 6 months. cookie_name: 'openid_provider', cookie_path: '/', img_path: 'images/', input_id: null, provider_url: null, init: function(input_id) { var openid_btns = $('#openid_btns'); this.input_id = input_id; $('#openid_choice').show(); $('#openid_input_area').empty(); // add box for each provider for (id in providers_large) { openid_btns.append(this.getBoxHTML(providers_large[id], 'large', '.gif')); } if (providers_small) { openid_btns.append('<br/>'); for (id in providers_small) { openid_btns.append(this.getBoxHTML(providers_small[id], 'small', '.ico')); } } $('#openid_form').submit(this.submit); var box_id = this.readCookie(); if (box_id) { this.signin(box_id, true); } }, getBoxHTML: function(provider, box_size, image_ext) { var box_id = provider["name"].toLowerCase(); return '<a title="'+provider["name"]+'" href="javascript: openid.signin(\''+ box_id +'\');"' + ' style="background: #FFF url(' + this.img_path + box_id + image_ext+') no-repeat center center" ' + 'class="' + box_id + ' openid_' + box_size + '_btn"></a>'; }, /* Provider image click */ signin: function(box_id, onload) { var provider = providers[box_id]; if (! provider) { return; } this.highlight(box_id); this.setCookie(box_id); // prompt user for input? if (provider['label']) { this.useInputBox(provider); this.provider_url = provider['url']; } else if(provider['form_url']) { $('#openid_form').attr("action", provider['form_url']); $('#openid_form').submit(); } else { this.setOpenIdUrl(provider['url']); if (! onload) { $('#openid_form').submit(); } } }, /* Sign-in button click */ submit: function() { var url = openid.provider_url; if (url) { url = url.replace('{username}', $('#openid_username').val()); openid.setOpenIdUrl(url); } return true; }, setOpenIdUrl: function (url) { var hidden = $('#'+this.input_id); if (hidden.length > 0) { hidden.value = url; } else { $('#openid_form').append('<input type="hidden" id="' + this.input_id + '" name="' + this.input_id + '" value="'+url+'"/>'); } }, highlight: function (box_id) { // remove previous highlight. var highlight = $('#openid_highlight'); if (highlight) { highlight.replaceWith($('#openid_highlight a')[0]); } // add new highlight. $('.'+box_id).wrap('<div id="openid_highlight"></div>'); }, setCookie: function (value) { var date = new Date(); date.setTime(date.getTime()+(this.cookie_expires*24*60*60*1000)); var expires = "; expires="+date.toGMTString(); document.cookie = this.cookie_name+"="+value+expires+"; path=" + this.cookie_path; }, readCookie: function () { var nameEQ = this.cookie_name + "="; var ca = document.cookie.split(';'); for(var i=0;i < ca.length;i++) { var c = ca[i]; while (c.charAt(0)==' ') c = c.substring(1,c.length); if (c.indexOf(nameEQ) == 0) return c.substring(nameEQ.length,c.length); } return null; }, useInputBox: function (provider) { var input_area = $('#openid_input_area'); var html = ''; var id = 'openid_username'; var value = ''; var label = provider['label']; var style = ''; if (label) { html = '<p>' + label + '</p>'; } if (provider['name'] == 'OpenID') { id = this.input_id; value = 'http://'; style = 'background:#FFF url('+this.img_path+'openid-inputicon.gif) no-repeat scroll 0 50%; padding-left:18px;'; } html += '<input id="'+id+'" type="text" style="'+style+'" name="'+id+'" value="'+value+'" />' + '<input id="openid_submit" type="submit" value="Sign-In"/>'; input_area.empty(); input_area.append(html); $('#'+id).focus(); } };

    Read the article

  • How do I reuse code in Zend Framework

    - by Mario
    I am working on a web application which requires the user to login before they see or do anything. No part of this app should be accessible without being logged in. (Except of course, the login controller) Currently I am using sessions to handle the authentication and I have put code in each controller in the init() function to check if their session is valid. This was a temporary workaround, but it is redundant and inefficient. I would like my init() function to be similar to the following, but I am not sure how to achieve it: public function init() { // If user not logged in redirect to login controller $myLibrary = Zend_Library_MyLibrary(); $myLibrary->CheckAuth(); } So my question really has two parts: Where is the best place to store code that will be used in multiple controllers? How do I then call that function from a controller? Thanks.

    Read the article

  • jConfirm and onbeforeunload

    - by Dirty Bird Design
    I have a basic function to alert the user upon refresh, browser back button (except the submit button) or when a link is clicked they will lose form data from a form wizard. <script type="text/javascript"> var okToSubmit = false; window.onbeforeunload = function() { document.getElementById('Register').onclick = function() { okToSubmit = true; }; if(!okToSubmit) return "Using the browsers back button will cause you to lose all form data. Please use the Next and Back buttons on the form"; }; </script> Im using jAlert plug in for alerts and would like to use jConfirm for the function above. When I add jConfirm after "return" it works...for a second. it pops the warning and then the page refreshes and the dialog box goes away. Does anyone know how to fix this?

    Read the article

< Previous Page | 326 327 328 329 330 331 332 333 334 335 336 337  | Next Page >