Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 344/772 | < Previous Page | 340 341 342 343 344 345 346 347 348 349 350 351  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What is the best resource or method for learning more about servers and networking?

    - by kaleidomedallion
    I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

    Read the article

  • Script/scheduled task to clean up Dowloads folder (Windows 7)?

    - by Andrew
    My downloads folder is my primary connection to the internet (and thus the world), and has rapidly become a virtual junk drawer. I imagine I'm not alone here. What I'd like to do is have some sort of a script that -creates a new folder (named YYYY_MM Archive so it sorts nicely) -takes everything* inside of the Downloads folder (for the current user) -moves it to the new folder and have this run once/month. *(excluding previous archives) This strikes me as the type of thing Saw some answers on related questions that seemed to suggest that this is an eminently doable task in PowerShell. Is it? I'm on Windows 7 Enterprise.

    Read the article

  • Unable to start after 13.04 > 13.10 udate

    - by romainl
    At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

    Read the article

  • Is GPU active when there are not any monitors?

    - by Mixer
    Does GPU render anything when there is no monitor plugged in? Today I turned my old PC into some kind of a "server" which means that I want it running 24/7. I don't need any display (I will operate through ssh) so when everything was set up I removed my monitor. After a hour I checked my graphic card's cooling system and it was still hot. My graphic card is GeForce 8600 (with DVI connector), OS is Debian Linux. What is the best solution in this situation (standalone server) if GPU is active and I don't want it to waste power?

    Read the article

  • searchd under runit continues writing to the runit's log

    - by Eugene
    searchd (Sphinx) run file: #!/bin/sh set -e APP_PATH=/srv/application TARGET_USER=user exec chpst -u $TARGET_USER /usr/bin/searchd --pidfile --nodetach --config $APP_PATH/current/config/production.sphinx.conf tail /var/log/sphinx/current 2014-06-07_18:13:56.87885 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.13740 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.88113 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.89167 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.75555 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.81554 precached 9 indexes in 0.497 sec 2014-06-07_18:14:00.33466 precached 9 indexes in 0.497 sec ... it continues to write the same line until sv stop sphinx ... Everything works fine, seachd starts and responds to the queries. But how to make logs to be less repetitive? When I start Sphinx manually it prints the "precached 9 indexes" just once.

    Read the article

  • My Mac Book Pro is turning itself, on my bagpack

    - by J. Pablo Fernández
    This happens to me twice: I press the power button on my Mac Book Pro, I choose sleep, I close it, I unplug everything, I confirm that is off (by pressing my ear to it) and put it in my back. Some minutes latter it wakes up by itself. Both times I caught it in time, well, the second time it was so hot I couldn't touch some parts and it was refusing to actually wake up, the screen was blank. Restarting it worked though. Any ideas what might be going on and/or how to prevent this?

    Read the article

  • Changing location in Google Chrome when searching

    - by Alex
    I've recently moved to the Czech Republic from Scotland and I can't find a way to permanently stop Google from automatically defaulting back to google.cz all the time. I've checked to ensure that all my google accounts and cookie based settings (e.g. Advanced Search Options) are set to English but it's still clearly doing an IP address lookup and disregarding everything else. The default Search Engine for Google Chrome (and switches to google.cz automatically): {google:baseURL}search?{google:RLZ}{google:acceptedSuggestion}{google:originalQueryForSuggestion}sourceid=chrome&ie={inputEncoding}&q=%s I've tried hardcoding it to: http://www.google.com/search?{google:RLZ}{google:acceptedSuggestion}{google:originalQueryForSuggestion}sourceid=chrome&ie={inputEncoding}&q=%s this kind of works, but won't work for inline searching, i.e. I always have to press enter in order to get any results which is a bit annoying as I've gotten so used to AJAX style searching I can't have been the only one to get this issue? Any help is appreciated

    Read the article

  • HP Virtual Connect and VLAN Tagging

    - by JaapL
    We have a c7000 chasis with the ability to have 8 uplinks per ESX host. Only 6 are currenlty active. I have a Virtual Switch with multiple vlan port groups and all the VMs are working fine. Recently we've been asked to setup network load balancing for one of our VMs, so we had our Virtual Connect engineer activate the last two uplinks. We then created a new vSwitch and added the two new uplinks to this vSwitch. We then moved the VM to this new vSwitch, but we get no connectivity. What could be the issue? We also added the appropriate VLAN ID. The VConnect engineer says everything is configured correctly and networking TEAM says the appropriate trunking is setup, so we are at a loss...

    Read the article

  • Why can't I install MySQL on my computer?

    - by Bea
    I have read a lot of tutorials, but I am still having problems. What I tried: I downloaded mysql-5.5.9-winx64. All that I read says that I can run Setup.exe, but there is no such file in the download. The other option I know there is, is including \mysql-5.5.9-winx64\bin in the PATH variable and then trying to execute the mysql command. When I do that, the error I get is: ERROR 2003 (HY000): Can't connect to MySQL server on 'localhost' (10061) I then downloaded mysql-5.5.9-winx64.msi, which is easier to install, but once I followed the instructions and it was installed, I got the same error executing the mysql command. How can I use MySQL? EDIT: I've now removed everything I installed, and I want to start from scratch.

    Read the article

  • Problems moving a rectangle in Pygame.

    - by Yann Core
    Hi guys! I'm making a game in Pygame and I want to be able to target enemy unit. I made it so when I click on them a variable "targeted" becomes true, and stays true until I click somewhere else on the screen. I also want targeted units to have a small green circle around them, so I made it in GEDIT. I have made a function that draws everything on the screen (the background, the player, objects, etc) and in the part where it draws the units it checks if the variable "targeted" is true and if it is it should move that little green circle over the enemy units. here is the code that does that: screen.blit(enemy_unit.pic, enemy_unit.rect) #draw the unit if enemy_unit.targeted == True: #if the unit has been targeted then draw a circle over it target_rect.move_ip(enemy_unit.pos) #move the circle to the unit target_rect.fit(enemy_unit.rect) #there are some bigger units and some smaller ones, so we have to "scale" the circle screen.blit(target_pic, target_rect) #actually draw the circle This doesn't work, when I target the unit the circle just appears for a 1/5 of second next (not on, but just next) to the unit and then disappears. I am sure that I am keeping a good track of "enemy_unit.pos" because I tested it (I added a piece of code that would print one units position and mouse's position every time i clicked the mouse and when i was near him the numbers were same). If you could give me a hint about what I'm doing wrong. I think its in move_ip function, but I tried just move and it didn't work either (the circle didn't even show at all)!

    Read the article

  • phpmyadmin or other mysql gui - edit whole table from one screen

    - by lorem
    Let's say I have table in database. I'd like to be able to view all data from this table and be able to edit every field from single screen. I tried to do this in phpmyadmin but I'm not sure how... I can see all data but I have to click edit on single field and then I'm sent to next screen, can't really edit everything at once. How do I do this in phpmyadmin or other mysql gui? I'm on Linux, my server too. I'd like each field in table to be editable text field - maybe this will show better what I'm searching for.

    Read the article

  • Node.js installation on Debian 6

    - by pvorb
    I used to use this method for node.js installation on Debian, since it was easy and everything worked fine. Even with multiple users. Since version 0.6.18~dfsg1-1 of the sid package, installation removes openssh-server. But I need OpenSSH to connect to my server. Is there any possibility to install Node.js via APT or do I have to compile it manually? This is my APT preferences file: Package: * Pin: release a=stable Pin-Priority: 800 Package: * Pin: release a=testing Pin-Priority: 650 Package: * Pin: release a=unstable Pin-Priority: 600

    Read the article

  • How can I reset windows 7 file permissions?

    - by ssb
    I looked at this post and it seemed to be close to what I want, but my case might be a little worse: How can I reset my windows 7 file permissions to a rational state? Basically a while back I (very stupidly) changed the permissions on all sorts of system folders, and eventually rendered my computer virtually unusable. I managed to hack administrator privileges back onto key folders and getting it working, but in doing so I only modified permissions a lot more away from the natural state. I'm looking at this icacls stuff, but ultimately I need to reset EVERYTHING back to what it was in The Beginning, before I messed with it, from the C: directory all the way down. Right now application data is what's giving me problems, and I can't get it to work no matter how much I fiddle with those specific permissions. I will be forever grateful for help on how to do this without having to reformat.

    Read the article

  • Looking for job advice [closed]

    - by EntryLevelJavaDeveloper
    I am a software developer for a government agency in DC, and I have recently completed one year of employment. I am generally dissatisfied with my experiences here. I do not want to gripe too much, but I do not spend a lot of time doing actual development on projects. I am asked to do everything under the sun: write requirements, review specs, test, attend random meetings, but actual coding makes up a small fraction of my time. The coding itself is fairly straightforward and simple so it feels like I am not growing from my experiences. I am not tasked with more challenging work, and I find the experiences are not rewarding. If I had a stronger resume/more work experience, I'd leave the position immediately but combined with the present economy, I am hesitant to leave. I have several questions: Does anybody have experiences like this? How did you make the most of it? I am currently doing some side projects, making simple webpages for people, but aside from that, and open source projects, what other things are out there? What are general benchmarks for a developer after one year of professional experience? What should I be expected to know/do? I am outsider (coming from a math/science background) so I do not know what exactly I should know/do. Is it possible to obtain a mentorship with a mid/senior developer to learn? If so, how can I go about making contacts in the DC area?

    Read the article

  • Somehow Google considers a properly 301'd URL as 200 and is still indexing the new content in old page?

    - by user2178914
    We redirected all the old URL's to new ones properly using htaccess. The problem is Google, somehow is still finding content in the old page(which it shouldn't) and stores it in the cache rather than the new URL. For eg: Old Page- http://www.natures-energies.com/iching.htm New Page- http://www.natures-energies.com/index.php?option=com_content&view=article&id=760 If you type the old URL into the browser it redirects If you fetch the old URL as Googlebot in the webmaster tools the header says 301/permanently redirected. If I try to crawl as any other bot it still says 301 redirected. Even if you click the old link in Google it redirects to the new URL. Only in its cache it shows the old URL and moreover it shows the new content in it! I am stumped on how Google manages to grab the new content and puts in the old URL instead of the new one! One more interesting thing is that if I try a cache for the new page it shows the cache of the new content with old URL! Any help would be appreciated. I am at end of my wits. I think i have tried almost everything. Is there anything that I'm missing to see? You can use this search to find the old url's. Maybe you'll some patterns that i missed. site:www.natures-energies.com inurl:htm -inurl:https|index

    Read the article

  • SharePoint Session Management - which SQL Server option?

    - by frumious
    We're developing some custom web parts for our WSS 3 intranet, and have just run into something we'd like to use ASP.NET sessions for. This isn't currently enabled on the development server. We'd like to use SQL Server as the storage mechanism, because the production environment is a web farm with very simple load-balancing. There are 3 options you can choose from to set up the SQL Server session storage, tempdb, default separate DB, named DB. Both tempdb and default separate DB create a new DB to store certain information in; tempdb stores the actual session info in tempdb, which doesn't survive a reboot, and default separate DB stores everything in the new DB. Since you've got to create the new DB either way, my question is this: why would you ever choose to store the session info in tempdb? The only thing I can think of is if you'd like to have the ability to wipe the session by rebooting the server, but that seems quite apocalyptic!

    Read the article

  • How to tell if my sound card is listed in Device Manager?

    - by Bruhan
    The sound on my computer suddenly stopped working. When I check Sounds and Audio Devices in the Control Panel, I get "No Audio Device" with everything grayed out. When I check the Device Manager under "Sound, video and game controllers" I see the following list: Audio Codecs Legacy Audio Drivers Legacy Video Capture Devices Media Control Devices MPU-401 Compatible MIDI Device Standard Game Port Video Codecs None of these looks like my sound card. Of course, my sound "card" is not really a sound card, it's integrated with the nVidia-nForce motherboard. I'm running Windows XP. So is one of the above my sound device, or is the OS not detecting it? If the latter, how do I get it to detect it?

    Read the article

  • Bringing the xenbr0 interface up on XEN under Ubuntu 8.04

    - by iyl
    I installed XEN on Ubuntu 8.04 using this tutorial: http://www.howtoforge.com/ubuntu-8.04-server-install-xen-from-ubuntu-repositories but after I reboot with the XEN kernel, I don't have xenbr0 device. I see that network-bridge script runs and it creates peth0 device, but not xenbr0. I have a very basic IP setup, with a single static IP defined in /etc/network/interfaces. The only unusual thing is that my hosting (1&1) gave me a netmask 255.255.255.255, so I had to add the default gateway with this script: /sbin/route add -host 10.255.255.1 dev eth0 /sbin/route add default gw 10.255.255.1 Everything else is plain vanilla Ubuntu 8.04.

    Read the article

  • Why is only one domU giving me the "time went backwards"?

    - by Paul Tomblin
    I'm setting up a replacement server for one that was working ok but is having hardware issues. The original server is i686 (Pentium III), but the new one is amd64 (Xeon). Everything is working fine, except one of the three domUs is giving me the "clocksource/0: Time went backwards" error. The Debian Wiki says what to do if all your domUs are getting this error, but not what to do if only one of them has. The "tenants" on my domUs have done some messing about with the systems I configured for them. I don't know what the user of that particular domU might have done.

    Read the article

  • Determining whether two fast moving objects should be submitted for a collision check

    - by dreta
    I have a basic 2D physics engine running. It's pretty much a particle engine, just uses basic shapes like AABBs and circles, so no rotation is possible. I have CCD implemented that can give accurate TOI for two fast moving objects and everything is working smoothly. My issue now is that i can't figure out how to determine whether two fast moving objects should even be checked against each other in the first place. I'm using a quad tree for spacial partitioning and for each fast moving object, i check it against objects in each cell that it passes. This works fine for determining collision with static geometry, but it means that any other fast moving object that could collide with it, but isn't in any of the cells that are checked, is never considered. The only solution to this i can think of is to either have the cells large enough and cross fingers that this is enough, or to implement some sort of a brute force algorithm. Is there a proper way of dealing with this, maybe somebody solved this issue in an efficient manner. Or maybe there's a better way of partitioning space that accounts for this?

    Read the article

  • IIS FTP server not working after purchase of SSL certificate

    - by Chris
    I've been connecting to my web server with active mode in FileZilla with no problems. Over the weekend, an SSL certificate was dropped into a folder that I access with FTP, and which contains files for the website. Now I am receiving a 425 error in active mode on the FTP root, so I can't really do anything but log in. In passive mode, I can connect and move around in the directory tree, but the connection seems shaky. Occasionally I'll time out, and I can't get access at all to the folder containing the SSL certificate. My question is how does the SSL certificate affect my FTP connection (if at all)? Does its presence demand the use of FTP over SSL? Note: As far as I know, the only change which occurred was the placement of the SSL certificate. Firewall settings, FTP client and server settings should all be the same as before, when everything was working.

    Read the article

  • how to actually install PHP etc on a windows 2003 server

    - by user1624421
    We're just purchasing a dedicated windows 2003 server (in fact I think it's a VPS) How do we actually go about installing software on to it? Simply searching for "installing PHP5 on windows server" just produces material about installing it as if one had access to the computer with a keyboard and mouse. Am I being thick? I've had experience managing a linux server before but that had everything pre-configured and we accessed it via Web Hosting Manager. I don't get the actual concept of connecting to a remote PC and...downloading files? If there's any good books available please point me in the right direction.

    Read the article

  • When I type " nothing comes out, and if I type it again, 2 of it comes out as such: ""

    - by Pacerier
    Something is wrong with my keyboard?: when I type ", nothing comes out, and if I type it again, 2 of them come out as such: "". Same goes with the ' key. The first time I type it, nothing comes out, then if I hit it again two of them appear (so I have to backspace one of them everytime). I've got no idea what I did to my computer, it was working properly yesterday. (I think I was messing around with the language thing, however I've just undid everything I've did and its still not working.)

    Read the article

  • Getting a Cross-Section from Two CSV Files

    - by Jonathan Sampson
    I have two CSV files that I am working with. One is massive, with about 200,000 rows. The other is much smaller, having about 12,000 rows. Both fit the same format of names, and email addresses (everything is legit here, no worries). Basically I'm trying to get only a subset of the second list by removing all values that presently exist in the larger file. So, List A has ~200k rows, and List B has ~12k. These lists overlap a bit, and I'd like to remove all entries from List B if they also exist in List A, leaving me with new and unique values only in List B. I've got a few tooks at my disposal that I can use. Open Office is loaded on this machine, along with MySQL (queries are alright). What's the easiest way to create a third CSV with the intersection of data?

    Read the article

< Previous Page | 340 341 342 343 344 345 346 347 348 349 350 351  | Next Page >