Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 345/772 | < Previous Page | 341 342 343 344 345 346 347 348 349 350 351 352  | Next Page >

• USB drivers stopped working in Windows 8

  - by Maxim V. Pavlov

  I have installed an MSDN version of Windows 8 Professional (x64) RTM. For about 3 restarts everything worked well. But once I've rebooted again - USB drivers (all of them, inluding the USB 3 drivers) stopped working. Device Manager properties said that the USB driver is not compatible with the system. Gigabyte doesn't list Windows 8 drivers for my MB X58A-UD3R. Tried to reinstall windows 7 USB drivers - system said the current driver is fine and didn't want to reinstall. Is this the common Windows 8 problem? How can solve it or debug it even more?

  Read the article

• Ubuntu 12.04 gets overheated, whereas I have no heating problems on Windows 7 whatsoever

  - by G K

  I bought a new laptop which came pre-installed with Windows 7. I love working on Ubuntu and hence installed it. I can work on Windows for 6 hours at a stretch and feel the laptop being only slightly warm, but 15 minutes into running Ubuntu and my laptop is too hot. The battery also drains out very quickly on Ubuntu. 1.5 hrs of backup on Ubuntu compared to 5-6 hrs on Windows. I previously owned a Dell Inspiron N5010 and everything ran smoothly on that. No heating issues. It came with intel i3 processor. So I'm wondering whether this problem has something to do with the processor? (AMD A8) Specs: HP Pavilion G6-2005AX Laptop (APU Quad Core A8/ 4GB/ 500GB/ Win7 HB/ 1.5GB Graph) 1 GB AMD Radeon HD 7670M Dedicated 512 MB AMD Radeon HD 7640G Graphics Integrated Is there any fix for this problem? Thanks in advance. Edit: I've installed ATI proprietary drivers suggested by Ubuntu.

  Read the article

• How to Check the Performance of VPS?

  - by Ngu Soon Hui

  I have subscribed to a VPS offered by a hosting provider. The guaranteed performance 1GB RAM, 1M bandwidth. But I found that from time to time the websites can be very slow, so slow that it could take more than 30 seconds to load a simple Joomla website. However the website resumed the usual speed after a few minutes. This created a problem for me when I want to report the performance problem to the hosting provider. They would say to me "see, no problem". Of course there is no problem because the problem is only there for a few minutes , and everything is normal. This ocassionally-slow problem will bug me a few days later and the cycle repeats. Any idea how to solve this problem?

  Read the article

• In developing a soap client proxy, which return structure is easier to use and more sensible?

  - by cori

  I'm writing (in PHP) a client/proxy for a SOAP web service. The return types are consistently wrapped in response objects that contain the return values. In many cases this make a lot of sense - for instance when multiple values are being returned: GetDetailsResponse Object ( Results Object ( [TotalResults] => 10 [NextPage] => 2 ) [Details] => Array ( [0] => Detail Object ( [Id] => 1 ) ) ) But some of the methods return a single scalar value or a single object or array wrapped in a response object: GetThingummyIdResponse Object ( [ThingummyId] => 42 ) In some cases these objects might be pretty deep, so getting at properties within requires drilling down several layers: $response->Details->Detail[0]->Contents->Item[5]->Id And if I unwrap them before passing them back I can strip out a layer from consumers' code. I know I'm probably being a little bit of an Architecture Astronaut here, but the latter style really bug me, so I've been working through my code to have my proxy methods just return the scalar value to the client code where there's no absolute need for a wrapper object. My question is, am I actually making things more difficult for the consumers of my code? Would I be better off just leaving the return values wrapped in response objects so that everything is consistent, or is removing unneccessary layers of indirection/abstraction worthwhile?

  Read the article

• Why can't I access the WebUI of my DNS-323 NAS after a firmware upgrade?

  - by anonymous2

  Hi Everyone, I just bought a D-Link DNS-323 NAS Enclosure, and have run into a problem. I read that the firmware that had shipped with (1.07) did not support 2TB drives, so I downloaded firmware 1.08. Turned on the device for thwe first time and went straight to the WebUI (everything looked/worked fine) Proceeded with the firmware update, completed successfully. Rebooted and I cannot access the WebUI. I can see the NAS connected via my router interface I can also ping the ip adress assigned, but I cannot access the WebUI or find it via D-Link easy search software. I have tried the factory reset button, but that does not seem to be doing anything, the square blue light just keeps flashing from the moment the unit is powered on, whether I press the reset button or not, and the symptoms remain the same... PS. I did/do not have any drives installed yet. Please help?

  Read the article

• After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

  - by RayofCommand

  We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

  Read the article

• How change the layout (e.g. background-color) of autoplaylists in foobar2000?

  - by UdeF

  A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

  Read the article

• What's wrong with this Open GL ES 2.0. Shader?

  - by Project Dumbo Dev

  I just can't understand this. The code works perfectly on the emulator(Which is supposed to give more problems than phones…), but when I try it on a LG-E610 it doesn't compile the vertex shader. This is my log error(Which contains the shader code as well): EDITED Shader: uniform mat4 u_Matrix; uniform int u_XSpritePos; uniform int u_YSpritePos; uniform float u_XDisplacement; uniform float u_YDisplacement; attribute vec4 a_Position; attribute vec2 a_TextureCoordinates; varying vec2 v_TextureCoordinates; void main(){ v_TextureCoordinates.x= (a_TextureCoordinates.x + u_XSpritePos) * u_XDisplacement; v_TextureCoordinates.y= (a_TextureCoordinates.y + u_YSpritePos) * u_YDisplacement; gl_Position = u_Matrix * a_Position; } Log reports this before loading/compiling shader: 11-05 18:46:25.579: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x51984000 size:5570560 offset:4956160 fd:46 11-05 18:46:25.629: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x5218d000 size:5836800 offset:5570560 fd:49 Maybe it has something to do with that men alloc? The phone is also giving a constant error while plugged: ERROR FBIOGET_ESDCHECKLOOP fail, from msm7627a.gralloc Edited: "InfoLog:" refers to glGetShaderInfoLog, and it's returning nothing. Since I removed the log in a previous edit I will just say i'm looking for feedback on compiling shaders. Solution + More questions: Ok, the problem seems to be that either ints are not working(generally speaking) or that you can't mix floats with ints. That brings to me the question, why on earth glGetShaderInfoLog is returning nothing? Shouldn't it tell me something is wrong on those lines? It surely does when I misspell something. I solved by turning everything into floats, but If someone can add some light into this, It would be appreciated. Thanks.

  Read the article

• xen virtual machines get to many porcentages of cpus

  - by ki0

  Hi everyone, This is my question. I have one Xen server with 8 CPU's and 6 virtual machine running, each virtual hard disk are running in diferent physical hardisk. Everything worked fine but sometimes one virtual machine get almost whole CPU, if the Domain-0 is 90% that is normal, the virtual machine is 500% usage of CPU. I have improved that it is not depends who are working with the VM even when nobody are working with the server this still happens. I dont know what happen. Anyone have any idea?¿ or anyone have happened the same?¿

  Read the article

• Prevent Excel Chart Data Labels overlapping

  - by Nicholas

  I have an Excel dashboard with line charts containing data labels. Specifically, we are only using the data labels at the rightmost end of the lines, and the labels consist of the Series name and final value. By changing a dropdown, the dashboard is automatically updated to give 19 different dashboards. The problem is that we can't work out any way of preventing the labels overlapping. Everything else on the dashboard can be made to automatically update nicely, except for this. Can anybody think of a way to do this? E.g. plugin or macro.

  Read the article

• Does Windows 8 support the "start in [folder]" property for shortcuts?

  - by FumbleFingers

  I use Foobar2000 to play music, and for years now I've run it in what they call "portable mode". What that means is that the program itself isn't actually "installed" in the traditional Windows sense. All "non-system" dll's required by the application are in the same folder as the executable; earlier versions of Windows find them there, and everything runs fine. But Windows 8 fails because it doesn't find them. I want things set up this way because I keep Foobar2000 on a portable external hard drive, so I can just move it between different computers without having to go through the Windows install process. With all previous versions of Windows, I could either directly run the application from File Explorer, or create a shortcut on the desktop with the "start in folder" property set to the actual folder containing the program. I can still use the first method, but I want a shortcut! Is there any way to do what I want?

  Read the article

• A Duplicate name exists on the network

  - by Adam

  Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

  Read the article

• It takes a long time until windows xp recognize I connected USB diks

  - by Pavol G

  Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• trying to set up wireless router, failing

  - by j j

  Hi, I am trying to set up Netgear's wireless-n WNR2000 router, following their oversimplified 5- step process for plugging in wires, and I'm not having any success. It comes down to: once everything is wired and turned on in the correct order, all of the LEDs match the image they give of 'what should be lit up', but their setup disk still doesn't find the router. They have a site to set up the router manually, www.routerlogin.net, which I cannot navigate to, even while wired directly to the router. http://192.168.1.1 doesn't connect to anything, either. The interesting part: i get ping replies from Google's DNS server at 8.8.8.8 while this is set up. but cannot connect to any web site by name, since the router's DNS isn't set up. One thought is that the router and modem both have the same IP address, so it's conflicting, but I'm not sure how I'd resolve that. Any ideas?

  Read the article

• Flashing cursor with new laptop battery

  - by Fuzzy Purple Monkey

  I recently purchased a new, non-Toshiba battery for my Toshiba M700 tablet/laptop. The battery fits fine and the tablet detects and charges it, but when I try to boot up all I get is the Toshiba logo then a flashing cursor in the top-left. I can get to the bios, but no further. If I put the old battery back in, everything boots up fine. Has anyone else seen this problem? What am I missing? Thanks in advance!

  Read the article

• Ubuntu 10.4 No internet

  - by Keeper780

  I have Ubuntu 10.4 dual booted with Windows Vista on a work Lenovo R61 laptop. The home and work wireless connection were working fine. I lost all internet connection at work. The IT guy clearly knew nothing about Linux. Since he 'fixed' it get nothing, no wlan signal the Network manager icon was gone, no internet. I still have the live disc and if I run from the live disc the connections are there and everything works perfectly. How do I restore the internet easily on my laptop. I have been using Linux for 3 Years but I am still a bit of a newbie, this is the first major problem I've had in three years. It's driving me nuts. Thanks

  Read the article

• Why can't I open programs after watching youtube videos for a while?

  - by manjivsanotsu

  I have recently built a new PC, and it worked fine for a while (1-2 months of no problems whatsoever). However in the recent weeks I noticed that after I watched some youtube videos and closed everything, I can no longer do anything except move the mouse and expand the Startup Menu. If I click on any of the programs on the Start Menu or type a program on the Run text box, it won't open anything. I can't open taskmgr, or windows explorer, or even shut down the PC. I don't have anything else running when I'm watching videos except ZoneAlarm and Avast. The only workaround I can do when this happens is a forced shutdown (holding the power button of my PC), and restart if I wanted to do anything more. But this happens a lot - about 4-5 times a week so I'm worried it would fry up my hardware if I keep on doing this. OS: Windows 7 Other Installed Software: Open Office, Tropico 4 game, Adobe Photoshop Browser used: Google Chrome Hardware: CPU: i7 2600K RAM: 16 GB Motherboard: Asus P8Z68-V GEN3 Hard Drive: 120GB Corsair Force GT SSD Graphics: 2047MB GeForce GTX 560 Ti

  Read the article

• Wireless adapter won't enable

  - by user52141

  I bought a d-link dwa-125, plugged it in and windows recognized it right away and said everything was good to go. But there were no connection options. When I open up the network control panel and have it show me the adapters... the wireless adapter is greyed out and says it is disabled. So I tell it to enable. It says is it enabling, then says it is enabled... but the adapter stayed greyed out saying disabled. I am running 7 x64. I have reinstalled drivers, connected it via lan and had it update drivers.. same problem. It works just fine on any other computer in the house, just not this one.

  Read the article

• How can I get better at explaining complex software processes to developers?

  - by Lostsoul

  I'm really struggling with my software specs. I am not a professional programmer but enjoy doing it for fun and made some software that I want to sell later but I'm not happy with the code quality. So I wanted to hire a real developer to rewrite my software in a more professional way so it will be maintainable by other developers in the future. I read and found some sample specs and made my own by applying their structure to my document and wanted to get my developer friend to read it and give me advice. After an hour and a half he understood exactly what I was trying to do and how I did it(my algorithms,stack,etc.). How can I get better at explaining things to developers? I add many details and explanations for everything(including working code) but I'm unsure the best way I can learn to pass detailed domain knowledge(my software applies big data, machine learning, graph theory to finance). My end goal is to get them to understand as much as possible from the document and then ask anything they do not understand, but right now it seems they need to extract alot of information from me. How can I get better at communicating domain knowledge to developers?

  Read the article

• Hard drive skipped in boot

  - by Yasin

  Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

  Read the article

• Make services not start automatically after reboot (as they require access to an encrypted partition)

  - by Binary255

  Hi, I use Ubuntu Server 10.04. I more or less only want the server to be accessible over SSH after a reboot. I will then login and mount the encrypted partition myself, after which I start the services which uses it. How would I go about setting something like that up? (My first idea was to have everything except /boot in an encrypted LVM, but I never got logging in through SSH and mounting the LVM to work. Initramfs was a bit too complicated for me. Otherwise I think this would have been the best solution.)

  Read the article

• Fedora 17 Hangup on Boot (plymouth-quit-wait)

  - by Joe

  I am having an issue after several updates where when I try to boot the boot animation "loads" then flashes with the fedora logo, and then sits there. After checking into it more I found that two services were failing to start. The first is tcsd.service and the second is plymouth-quit-wait.service. I was able to to disable tcsd.service (in the hopes I could boot without it), however I have been unable to do anything to the second service. I am running FC17 and the akmod nvidia drivers, on an ASUSG53SW. Everything is up to date as far as I know. What is the exact problem that I am facing and how can I go about troubleshooting this or fixing it?

  Read the article

• mysql is not using multiple cpus

  - by helpmhost

  Hi, Our MySQL server has been using a lot of CPU lately (it's reached 100% several times and stays there for a while) and I noticed that it the CPU load is all on one core of one cpu. I was hoping to spread that out to all 4 on my server. I have been tweaking the MySQL settings to use more ram and less cpu, but it still occasionally reaches very high CPU usage. It seems like everything about the topic refers to thread_concurrency (which I've read is a solaris only setting). What can I do in Linux? Thanks.

  Read the article

• Does /boot safe on top of a lvm LV (logical volume)?

  - by fantoman

  Title already asked the question. More specifically, I read in some documents that logical volumes are nice in general but not for /boot in a linux system. They say that bootloaders don't understand LVM volumes, so create a separate partition for /boot out of lvm. I recently installed Ubuntu server (9.10) for my home server, but by default /boot is created in the LVM. Everything is fine now, but I am not sure it is safe to use /boot in LVM. Second question is do I really need a physical partition (volume)(pv) for /boot or is it equally fine if I put it into a logical volume (lv) on top of a single shared volume group. Thanks in advance.

  Read the article

< Previous Page | 341 342 343 344 345 346 347 348 349 350 351 352  | Next Page >