Search Results

Search found 92226 results on 3690 pages for 'file access'.

Page 40/3690 | < Previous Page | 36 37 38 39 40 41 42 43 44 45 46 47  | Next Page >

  • Access DB Transaction Insert limit

    - by user986363
    Is there a limit to the amount of inserts you can do within an Access transaction before you need to commit or before Access/Jet throws an error? I'm currently running the following code in hopes to determine what this maximum is. OleDbConnection cn = new OleDbConnection( @"Provider=Microsoft.ACE.OLEDB.12.0;Data Source=C:\temp\myAccessFile.accdb;Persist Security Info=False;"); try { cn.Open(); oleCommand = new OleDbCommand("BEGIN TRANSACTION", cn); oleCommand.ExecuteNonQuery(); oleCommand.CommandText = "insert into [table1] (name) values ('1000000000001000000000000010000000000000')"; for (i = 0; i < 25000000; i++) { oleCommand.ExecuteNonQuery(); } oleCommand.CommandText = "COMMIT"; oleCommand.ExecuteNonQuery(); } catch (Exception ex) { } finally { try { oleCommand.CommandText = "COMMIT"; oleCommand.ExecuteNonQuery(); } catch{} if (cn.State != ConnectionState.Closed) { cn.Close(); } } The error I received on a production application when I reached 2,333,920 inserts in a single uncommited transaction was: "File sharing lock count exceeded. Increase MaxLocksPerFile registry entry". Disabling transactions fixed this problem.

    Read the article

  • should i advocate migrating from access to (my)sql

    - by HotOil
    Hi: We have a windows MFC app that is written against an access database on a company server. The db is not that big: 19 MB. There are at most 2-3 users accessing it at any one time. It is used in a factory environment where access speed (or lack thereof) over the intranet becomes noticeable as it is part of the manufacturing time for our widgets. The scenario is this: as each widget is completed, it gets a record in the db.. by the end of the year, the db is larger and searching for a record takes longer and longer. The solution so far has been to manually move older records to an archival table about once a year. We are reworking other portions of this app right now, and it would be a good time to move to another db if we are going to do it. It is my understanding that if we were using sql, the search time would not go up as the table gets bigger because the entire .mdb does not have to be sent over the network each time. Is this correct? Does anyone have any insight about whether it could be worth it to go to the trouble (time and money) of migrating to a new db, or should I just add more functionality to the application we have now, and maybe automatically purge the older records from time to time, and add additional facilities to the app to get at the older records when needed? Thanks for any wisdom you can share..

    Read the article

  • access settings from whole jquery component

    - by Pacuraru Daniel
    I am trying to develop a jquery component for dialog modals and i dont know how to access the settings from all component functions. I need to access settings,zIndex from open function and it seems to not work. (function($) { var methods = { init: function(options) { var defaults = { bgClass: "fancy-dialog-bg", bgShow: null, zIndex: 100, show: null }; var settings = $.extend(defaults, options); return this.each(function() { var obj = $(this).hide().css("position", "fixed").css("z-index", settings.zIndex).css("left", "300px").css("top", "200px"); }); }, open: function() { // alert(settings.zIndex); not working var tes = $("<div></div>").css("backgroundColor", "#f00").css("position", "fixed").css("z-index", "99").css("width", "50%").css("height", "100%").css("left", "0").css("top", "0"); $('body').append(tes); var obj = $(this); obj.show(); }, close: function() { var obj = $(this); $("#fancy-dialog-bg-" + obj.attr('id')).remove(); obj.hide(); } }; $.fn.fancyDialog = function(method) { if (methods[method]) { return methods[method].apply(this, Array.prototype.slice.call(arguments, 1)); } else if (typeof method === 'object' || !method) { return methods.init.apply(this, arguments); } else { $.error('Method ' + method + ' does not exist.'); } }; })(jQuery);

    Read the article

  • MS Access Bulk Insert exits app

    - by Brij
    In the web service, I have to bulk insert data in MS Access database. First, There was single complex Insert-Select query,There was no error but app exited after inserting some records. I have divided the query to make it simple and using linq to remove complexity of query. now I am inserting records using for loop. there are approx 10000 records. Again, same problem. I put a breakpoint after loop, but No hit. I have used try catch, but no error found. For Each item In lstSelDel Try qry = String.Format("insert into Table(Id,link,file1,file2,pID) values ({0},""{1}"",""{2}"",""{3}"",{4})", item.WebInfoID, item.Links, item.Name, item.pName, pDateID) DAL.ExecN(qry) Catch ex As Exception Throw ex End Try Next Public Shared Function ExecN(ByVal SQL As String) As Integer Dim ret As Integer = -1 Dim nowConString As String = "Provider=Microsoft.Jet.OLEDB.4.0;Data Source=" + System.AppDomain.CurrentDomain.BaseDirectory + "DataBase\\mydatabase.mdb;" Dim nowCon As System.Data.OleDb.OleDbConnection nowCon = New System.Data.OleDb.OleDbConnection(nowConString) Dim cmd As New OleDb.OleDbCommand(SQL, nowCon) nowCon.Open() ret = cmd.ExecuteNonQuery() nowCon.Close() nowCon.Dispose() cmd.Dispose() Return ret End Function After exiting app, I see w3wp.exe uses more than 50% of Memory. Any idea, What is going wrong? Is there any limitation of MS Access?

    Read the article

  • SQL query for an access database needed

    - by masfenix
    Hey guys, first off all sorry, i can't login using my yahoo provider. anyways I have this problem. Let me explain it to you, and then I'll show you a picture. I have a access db table. It has 'report id', 'recpient id', and 'recipient name' and 'report req'. What the table "means" is that do the user using that report still require it or can we decommission it. Here is how the data looks like (blocked out company userids and usernames): *check the link below, I cant post pictures cuz yahoo open id provider isnt working. So basically I need to have 3 select queries: 1) Select all the reports where for each report, ALL the users have said no to 'reportreq'. In plain English, i want a listing of all the reports that we have to decommission because no user wants it. 2) Select all the reports where the report is required, and the batchprintcopy is more then 0. This way we can see which report needs to be printed and save paper instead of printing all the reports. 3)A listing of all the reports where the reportreq field is empty. I think i can figure this one out myself. This is using Access/VBA and the data will be exported to an excel spreadsheet. I just a simple query if it exists, OR an alogorithm to do it quickly. I just tried making a "matrix" and it took about 2 hours to populate. https://docs.google.com/uc?id=0B2EMqbpeBpQkMTIyMzA5ZjMtMGQ3Zi00NzRmLWEyMDAtODcxYWM0ZTFmMDFk&hl=en_US

    Read the article

  • Access DB Transaction on insert or updating

    - by Raju Gujarati
    I am going to implement the database access layer of the Window application using C#. The database (.accdb) is located to the project files. When it comes to two notebooks (clients) connecting to one access database through switches, it throws DBConcurrency Exception Error. My target is to check the timestamp of the sql executed first and then run the sql . Would you please provide me some guidelines to achieve this ? The below is my code protected void btnTransaction_Click(object sender, EventArgs e) { string custID = txtID.Text; string CompName = txtCompany.Text; string contact = txtContact.Text; string city = txtCity.Text; string connString = ConfigurationManager.ConnectionStrings["CustomersDatabase"].ConnectionString; OleDbConnection connection = new OleDbConnection(connString); connection.Open(); OleDbCommand command = new OleDbCommand(); command.Connection = connection; OleDbTransaction transaction = connection.BeginTransaction(); command.Transaction = transaction; try { command.CommandText = "INSERT INTO Customers(CustomerID, CompanyName, ContactName, City, Country) VALUES(@CustomerID, @CompanyName, @ContactName, @City, @Country)"; command.CommandType = CommandType.Text; command.Parameters.AddWithValue("@CustomerID", custID); command.Parameters.AddWithValue("@CompanyName", CompName); command.Parameters.AddWithValue("@ContactName", contact); command.Parameters.AddWithValue("@City", city); command.ExecuteNonQuery(); command.CommandText = "UPDATE Customers SET ContactName = @ContactName2 WHERE CustomerID = @CustomerID2"; command.CommandType = CommandType.Text; command.Parameters.AddWithValue("@CustomerID2", custIDUpdate); command.Parameters.AddWithValue("@ContactName2", contactUpdate); command.ExecuteNonQuery(); adapter.Fill(table); GridView1.DataSource = table; GridView1.DataBind(); transaction.Commit(); lblMessage.Text = "Transaction successfully completed"; } catch (Exception ex) { transaction.Rollback(); lblMessage.Text = "Transaction is not completed"; } finally { connection.Close(); } }

    Read the article

  • Excel - Best Way to Connect With Access Data

    - by gamerzfuse
    Hello there, Here is the situation we have: a) I have an Access database / application that records a significant amount of data. Significant fields would be hours, # of sales, # of unreturned calls, etc b) I have an Excel document that connects to the Access database and pulls data in to visualize it As it stands now, the Excel file has a Refresh button that loads new data. The data is loaded into a large PivotTable. The main 'visual form' then uses VLOOKUP to get the results from the form, based on the related hours. This operation is slow (~10 seconds) and seems to be redundant and inefficient. Is there a better way to do this? I am willing to go just about any route - just need directions. Thanks in advance! Update: I have confirmed (due to helpful comments/responses) that the problem is with the data loading itself. removing all the VLOOKUPs only took a second or two out of the load time. So, the questions stands as how I can rapidly and reliably get the data without so much time involvement (it loads around 3000 records into the PivotTables).

    Read the article

  • Accessing an Access DB from Outlook via VBA

    - by camastanta
    Hi The situation: In Outlook I get a message from a server. The content of the message needs to be put into an Access db. But, there may not exist another message with the same date. So, I need to look into a db if there is already a message with the same date and time. If there exists one, then it needs to be replaced and otherwise the message needs to be added to the database. The database contains a list of current positions from the vehicles on the road. The problem: I have problems to compare a date time with a date time in an Access DB via VBA. The query I use returns no records but there is a record in the database. This is the query I use: adoRS.Open "SELECT * FROM currentpositions WHERE ((currentpositions. [dateLT])=" & "#" & date_from_message & "#" & ")", adoConn, adOpenStatic, adLockOptimistic Second I need to now what the result is of that query. How can I determine the number of records that my query gives me? Thanks camastanta

    Read the article

  • MS Access Form - Horizontal Anchor Affecting Data Update

    - by nicholas
    Running Access 2007 with a databound form. The form Record Source is set to a query, and all fields in the form have a defined Control Source; nothing fancy, just field names. The form is a Single form with record navigation buttons which perform a "Next Record" and "Previous Record" actions. As I navigate the records the controls in the header update correctly. However, if I change a control Horizontal Anchor property to "Right" the fields no longer update on record navigation. This is observed for both text box and combo box controls. I can switch the anchoring back to "Left" and the updating works as it should. Is there some reason anchoring would affect a control updating of in an Access form? Or is this a bug that has been observed before? The only workaround I can think of is to assign the control text/value property in the form OnCurrent event, but this seems somewhat sloppy. Am I missing something here?

    Read the article

  • PHP ODBC MDB Access on a Cloud Server

    - by Senica Gonzalez
    Hey! Hopefully quick question.... I have a .MDB file stored on my webserver and I'm trying to connect to it. I have no way of "registering" it with a name in ODBC. Is the only way to connect to it by specifying the absolute page of the .mdb file? $mdbFilename = "./db/Scora.mdb"; $connection = odbc_connect("Driver={Microsoft Access Driver (*.mdb)};Dbq=$mdbFilename","",""); if (!$connection) { echo "Couldn't make a connection!"; } $sql = "SELECT ID FROM ScoraRegistrations"; $sql_result = odbc_prepare($connection,$sql); odbc_execute($sql_result); odbc_result_all($sql_result,"border=1"); odbc_free_result($sql_result); odbc_close($connection); It never connects. Any thoughts?

    Read the article

  • How to compare 2 similar strings letter by letter and highlight the differences?

    - by PowerUser
    We have 2 databases that should have matching tables. I have an (In-Production) report that compares these fields and displays them to the user in an MS-Access form (continuous form style) for correction. This is all well and good except it can be difficult to find the differences. How can I format these fields to bold/italicize/color the differences? "The lazy dog jumped over a brown fox." "The lazy dog jumped over the brown fox." (It's easier to see the differences between 2 similiar text fields once they are highlighted in some way) "The lazy dog jumped over a brown fox." "The lazy dog jumped over the brown fox. " Since we're talking about a form in MS Access, I don't have high hopes. But I know I'm not the first person to have this problem. Suggestions?

    Read the article

  • Change field access to getter / setter method access

    - by Chris Dennett
    Hi everyone, is it possible to change external class field accesses in Java to getter / setter calls automatically, and also hide the exposed fields? I'm using Javabeans and I want change notifications when a field property changes (this is important). I've found cglib which can automatically insert the property change call to the PropertyChangeSupport field. I'd like this question to be a discussion of the issues posed and their solutions. I know about Project Lombok, but this appears to modify the source code, and additionally doesn't support field access modification. Perhaps with modifications to Lombok, this could be supported, or are there other solutions? Cheers and thanks in advance, Chris

    Read the article

  • Print ms access data in vb.net

    - by user225269
    How do I print the ms access data(.mdb) in vb.net? Here is the code that I'm using to view the data in the form. What I want to do is to be able to print what is currently being viewed. Perhaps automatically save the .pdf file and the pdf viewer installed on the system will open that newly generated pdf file Dim cn As New OleDbConnection("Provider=Microsoft.Jet.OLEDB.4.0;Data Source=C:\search.mdb") Dim cmd As OleDbCommand = New OleDbCommand("Select * from GH where NAME= '" & TextBox6.Text & "' ", cn) cn.Open() Dim rdr As OleDbDataReader rdr = cmd.ExecuteReader If rdr.HasRows Then rdr.Read() NoAcc = rdr("NAME") If (TextBox6.Text = NoAcc) Then TextBox1.Text = rdr("IDNUMBER") If (TextBox6.Text = NoAcc) Then TextBox7.Text = rdr("DEPARTMENT") If (TextBox6.Text = NoAcc) Then TextBox8.Text = rdr("COURSE") End If -some sites for beginners regarding this topic would help a lot:)

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Build an unbound form in Acess 2007

    - by DoubleJ92
    I have an access application that has a form that allows the user to enter case notes. The main field of this form is tied to a SQL Server varchar(MAX) field in the source table. Since the users switched to Access 2007, their program keeps crashing when they are on the case notes form. As a possible solution to this problem, I would like to try unbinding this form and re-building it as an unbound form. This form needs to be able to add and update records into my SQL Server database. It also needs to be able to browse between records. I guess I am at a loss as to where to start. Any suggestions/code snippets is appreciated.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Export and Import MS Access table defenitions as text files

    - by CodeSlave
    How can I export/import MS Access table definitions as text files (in a human readable format like I can with Forms or Reports)? I know how I can export the whole table out into CSV file; however: I don't need the data to go (actually really rather that it didn't) When I import a CSV file (especially without data) there's no guarantee that the data types will be the same as my original database. I'm hoping to store my table definitions in a SVN repository. I don't want to have to house any import specifications in the destination database.

    Read the article

  • Restricting Directory access from web application context

    - by Yogi
    i have a web application which stores users file in directory which is under webroot directory.. Suppose web application is under 'fileupload' and all files are getting stored in 'xyz' folder under 'fileupload' so now if user points to url say like www.xyzpqr.com/fileupload/xyz/abc.doc, he gets that file. How do i restirct this from happening.. i have thought of putting xyz folder in WeB-inf folder but as my application is very big i have to made changes at too many places.. so is there any way so that without moving the folder to web-inf (restricted folders) i can achieve wat i want..

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • PHP/Apache Deny folder access to user but not to script

    - by Piero
    Hey all, So I have this php web app, and one of my folder contains some files that can be downloaded. I have a download script that modifies the headers, in order to always offer a download link. (instead of showing a picture for example, when you click on a link, a download box pops out) Right now, if you enter a url like: http://www.mywebsite.com/content/ You get the listing of all the downloadable files, and of course, you can just download them all, without going through the website interface. Personally, I don't think it's a problem, since I often use downthemall or other downloading tool, and this type of access is a great time saver.... But of course my company does not think so :-p They want people to use the interface in order to view the Ads... Would they be a way, maybe with a protected .htaccess, to leave the folder access to my download script, but deny access to the users...? I hope I am making sense and you know what I mean :) All help/remarks appreciated!

    Read the article

  • Access Android 1.5 browser's gears-created database localy

    - by Sirber
    I created a database via javascript using Google Gears on Android 1.5 and I'd like to access directy the sqlite file to look inside it whitout using Gears. I found several "File Browser" but they only browse the SD card. Is there a way to fetch it from the phone file system? I have an HTC Dream running Androis 1.5. Thank you!

    Read the article

< Previous Page | 36 37 38 39 40 41 42 43 44 45 46 47  | Next Page >