Search Results

Search found 23474 results on 939 pages for 'xml import'.

Page 432/939 | < Previous Page | 428 429 430 431 432 433 434 435 436 437 438 439  | Next Page >

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • load a pickle file from a zipfile

    - by eric.frederich
    For some reason I cannot get cPickle.load to work on the file-type object returned by ZipFile.open(). If I call read() on the file-type object returned by ZipFile.open() I can use cPickle.loads though. Example .... import zipfile import cPickle # the data we want to store some_data = {1: 'one', 2: 'two', 3: 'three'} # # create a zipped pickle file # zf = zipfile.ZipFile('zipped_pickle.zip', 'w', zipfile.ZIP_DEFLATED) zf.writestr('data.pkl', cPickle.dumps(some_data)) zf.close() # # cPickle.loads works # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd1 = cPickle.loads(zf.open('data.pkl').read()) zf.close() # # cPickle.load doesn't work # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd2 = cPickle.load(zf.open('data.pkl')) zf.close() Note: I don't want to zip just the pickle file but many files of other types. This is just an example.

    Read the article

  • Java : HTTP POST Request

    - by SpunkerBaba
    I have to do a http post request to a web-service for authenticating the user with username and password. The Web-service guy gave me following information to construct HTTP Post request. POST /login/dologin HTTP/1.1 Host: webservice.companyname.com Content-Type: application/x-www-form-urlencoded Content-Length: 48 id=username&num=password&remember=on&output=xml The XML Response that i will be getting is <?xml version="1.0" encoding="ISO-8859-1"?> <login> <message><![CDATA[]]></message> <status><![CDATA[true]]></status> <Rlo><![CDATA[Username]]></Rlo> <Rsc><![CDATA[9L99PK1KGKSkfMbcsxvkF0S0UoldJ0SU]]></Rsc> <Rm><![CDATA[b59031b85bb127661105765722cd3531==AO1YjN5QDM5ITM]]></Rm> <Rl><![CDATA[[email protected]]]></Rl> <uid><![CDATA[3539145]]></uid> <Rmu><![CDATA[f8e8917f7964d4cc7c4c4226f060e3ea]]></Rmu> </login> This is what i am doing HttpPost postRequest = new HttpPost(urlString); How do i construct the rest of the parameters?

    Read the article

  • Java Web Service Client from Microsoft Live Search

    - by trendyy
    I generated java web service from here -- http://api.search.live.net/search.wsdl.. I want to make search and listing the return values. In my opinion i generated client and client is makes research but i can't display result, how i can do that.. Can anyone check my wrote code and help me about displaying result? Thanks... import java.rmi.RemoteException; import com.microsoft.schemas.LiveSearch._2008._03.Search.*; public class searchtry { public static void main(String[] args) throws RemoteException { LiveSearchPortTypeProxy client=new LiveSearchPortTypeProxy(); SearchRequest request=new SearchRequest(); SearchRequestType1 type1=new SearchRequestType1(); sorgu.setAppId("*********************************"); //Windows Live gave this id for using that service sorgu.setSources(new SourceType[]{SourceType.Web}); sorgu.setQuery("Java"); aratip.setParameters(request); SearchResponseType0 answer= client.search(type1); System.out.println(answer.toString()); }

    Read the article

  • dreamweaver sites

    - by ngreenwood6
    Hello, We have over 500 sites that we host. All of there ftp information is in a database. Whenever one of our programmers have to add a site they have to get all the info and set it up. However, I found that you can export them and it has all the info except for one problem. The password is encrypted. I am not trying to hack anything, I want to know how to encrypt our passwords so that we can import them using dreamweavers import feature. Can anyone tell me what encryption they use or a link on how to encrypt. I am not interested in decrypting at all because we already have all of them so it would not do me any good. Thanks for any help

    Read the article

  • Sending mail from Python using SMTP

    - by Eli Bendersky
    I'm using the following method to send mail from Python using SMTP. Is it the right method to use or are there gotchas I'm missing ? from smtplib import SMTP import datetime debuglevel = 0 smtp = SMTP() smtp.set_debuglevel(debuglevel) smtp.connect('YOUR.MAIL.SERVER', 26) smtp.login('USERNAME@DOMAIN', 'PASSWORD') from_addr = "John Doe <[email protected]>" to_addr = "[email protected]" subj = "hello" date = datetime.datetime.now().strftime( "%d/%m/%Y %H:%M" ) message_text = "Hello\nThis is a mail from your server\n\nBye\n" msg = "From: %s\nTo: %s\nSubject: %s\nDate: %s\n\n%s" % ( from_addr, to_addr, subj, date, message_text ) smtp.sendmail(from_addr, to_addr, msg) smtp.quit()

    Read the article

  • Issue with XSLT Processing on PHP

    - by monksy
    I'm getting a few errors from XSLTProcessor: XSLTProcessor::transformToDoc() [<a href='function.XSLTProcessor-transformToDoc'>function.XSLTProcessor-transformToDoc</a>]: Invalid or inclomplete context XSLTProcessor::transformToDoc() [<a href='function.XSLTProcessor-transformToDoc'>function.XSLTProcessor-transformToDoc</a>]: XSLTProcessor::transformToDoc() [<a href='function.XSLTProcessor-transformToDoc'>function.XSLTProcessor-transformToDoc</a>]: xsltValueOf: text copy failed in Which is parsing this XSLT Line: <xsl:apply-templates select="page/sections/section" mode="subset"/> The section is: <xsl:template match="page/sections/section" mode="subset"> <a href="#{shorttitle}"> <xsl:value-of select="title"/> </a> <xsl:if test="position() != last()"> | </xsl:if> </xsl:template> The XML that the section is parsing is: <shorttitle>About</shorttitle> <title>#~ About</title> The PHP XSLT Code is: $xslt = new XSLTProcessor(); $XSL = new DOMDocument(); $XSL->load( $xsltFile, LIBXML_NOCDATA); $xslt->importStylesheet( $XSL ); print $xslt->transformToXML( $XML ); My suspicion about the the errors is due to content. I'm not getting these errors with Firefox's XSLT rendering, nor am I getting an invalid XML document on the backend.I'm not getting errors on the load, its just on the transformToXML function. Does anyone have a clue on how to solve this? This is with PHP5.

    Read the article

  • How can I handle template dependencies in Template Toolkit?

    - by Smack my batch up
    My static web pages are built from a huge bunch of templates which are inter-included using Template Toolkit's "import" and "include", so page.html looks like this: [% INCLUDE top %] [% IMPORT middle %] Then top might have even more files included. I have very many of these files, and they have to be run through to create the web pages in various languages (English, French, etc., not computer languages). This is a very complicated process and when one file is updated I would like to be able to automatically remake only the necessary files, using a makefile or something similar. Are there any tools like makedepend for C files which can parse template toolkit templates and create a dependency list for use in a makefile? Or are there better ways to automate this process?

    Read the article

  • Looking for Reachability (2.0) Use Case Validation

    - by user350243
    There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

    Read the article

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • Rails does not display error messages on a form in a custom method

    - by slythic
    Hi all, I've created a custom method called checkout in my app. I create an order (which is done my adding products to my "cart"), assign it to my client, and then I head to my checkout screen where I confirm the items and enter their customer order number and complete the order (submit). Everything works great except that it doesn't display error messages. I'm able to display a flash error notice (seen in complete_order method) when things go wrong but it doesn't specify the details like a normal form would. The error messages should appear if the customer order number is not unique for that client. Below is the custom method (checkout) related code. Order Model: validates_uniqueness_of :customer_order_number, :scope => :client_id Orders_controller: def checkout @order = current_order end def complete_order @order = current_order respond_to do |format| if @order.update_attributes(params[:order]) @order.complete #sets submitted datetime and state to 'complete' flash[:notice] = 'Thank you! Your order is being processed.' format.html { redirect_to( products_path ) } format.xml { head :ok } else flash[:error] = 'Please review your items' #added to confirm an error is present format.html { redirect_to( checkout_path ) } format.xml { render :xml => @order.errors, :status => :unprocessable_entity } end end end And the form in the checkout view: <% form_for @order, :url => { :controller => "orders", :action => "complete_order" } do |f| %> <%= f.error_messages %> <%= f.text_field :customer_order_number, :label => "Purchase Order Number" %> <p> <%= f.submit 'Complete Order', :confirm => 'Are you sure?' %> <small> or <%= link_to 'cancel', current_cart_path %></small> </p> <% end %> Any idea how I can display the specific error messages? Thank you in advance! -Tony

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • jquery Append Issue

    - by 3gwebtrain
    I am getting the append issue with this code. In my xml i go 2 no. of "listgroup" and jquery print propelry. but within the earch "listgroup", first group contain 6 points and second group contain 6 point. these 2 section has to print separately to 'ul' element. But my problem is first time while it print itself both 12points in first ul i am getting and it print 6 pint to second ul propelry.. what i want is, first ul has to have 6 points and second has6 point what it has in the xml tree... $(function(){ $.get('career-utility.xml',function(myData){ $(myData).find('listgroup').each(function(index){ var listGroup = $(this); var listGroupTitle = $(this).attr('title'); var shortNote = $(this).attr('shortnote'); var subLink = $(this).find('sublist'); var firstList = $(this).find('list'); $('.grouplist').append('<div class="list-group"><h3>'+listGroupTitle+'</h3><ul class="level">'+index+'</ul></div>'); $(this).children().each(function(num){ var text = $(this).text(); $('<li>'+text+'</li>').appendTo('ul.level'); }) }) }) })

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • VEMap and a GeoRSS feed(hosted separately)

    - by Alexis Abril
    The scenario is as follows: A WCF web service exists that outputs a valid GeoRSS feed. This lives in its own domain as a number of different applications have access to it. A web page(on a different site) has been created with an instance of a VEMap(Bing/Virtual Earth map object). Now, VEMap can accept an input feed in this format via the following: var layer = new VEShapeLayer(); var veLayerSpec = new VEShapeSourceSpecification(VEDataType.GeoRSS, "someurl", layer); map.ImportShapeLayerData(veLayerSpec, onComplete, true); onComplete is a callback function I'm using to replace the default pin graphic with something custom. The question is in regards to "someurl", which is a path to a local xml file containing the geographic information(georss simple format). I've realized this feed and the map must be hosted in the same domain, so I've created a generic handler that reads the remote feed and returns it in the same format. var veLayerSpec = new VEShapeSourceSpecification(VEDataType.GeoRSS, "/somelocalhandler.ashx", layer); When I do this, I get the VEMap error("z is null"). This is the same error one would receive when trying to access a remote feed. When I copy the feed into a local xml file(ie, "feed.xml") there is no error. The order of operations is currently: remote feed - local handler - VEMap import If I'm over complicating this procedure, let me know! I'm a bit new to the Bing Maps API and might have missed something. Any assistance is appreciated.

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Cannot instantiate abstract class or interface : problem while persisting

    - by sammy
    i have a class campaign that maintains a list of AdGroupInterfaces. im going to persist its implementation @Entity @Table(name = "campaigns") public class Campaign implements Serializable,Comparable<Object>,CampaignInterface { private static final long serialVersionUID = 1L; @Id @GeneratedValue(strategy = GenerationType.IDENTITY) private Long id; @OneToMany ( cascade = {CascadeType.ALL}, fetch = FetchType.EAGER, targetEntity=AdGroupInterface.class ) @org.hibernate.annotations.Cascade( value = org.hibernate.annotations.CascadeType.DELETE_ORPHAN ) @org.hibernate.annotations.IndexColumn(name = "CHOICE_POSITION") private List<AdGroupInterface> AdGroup; public Campaign() { super(); } public List<AdGroupInterface> getAdGroup() { return AdGroup; } public void setAdGroup(List<AdGroupInterface> adGroup) { AdGroup = adGroup; } public void set1AdGroup(AdGroupInterface adGroup) { if(AdGroup==null) AdGroup=new LinkedList<AdGroupInterface>(); AdGroup.add(adGroup); } } AdGroupInterface's implementation is AdGroups. when i add an adgroup to the list in campaign, campaign c; c.getAdGroupList().add(new AdGroups()), etc and save campaign it says"Cannot instantiate abstract class or interface :" AdGroupInterface its not recognizing the implementation just before persisting... Whereas Persisting adGroups separately works. when it is a member of another entity, it doesnt get persisted. import java.io.Serializable; import java.util.List; import javax.persistence.*; @Entity @DiscriminatorValue("1") @Table(name = "AdGroups") public class AdGroups implements Serializable,Comparable,AdGroupInterface{ /** * */ private static final long serialVersionUID = 1L; private Long Id; private String Name; private CampaignInterface Campaign; private MonetaryValue DefaultBid; public AdGroups(){ super(); } public AdGroups( String name, CampaignInterface campaign) { super(); this.Campaign=new Campaign(); Name = name; this.Campaign = campaign; DefaultBid = defaultBid; AdList=adList; } @Id @GeneratedValue(strategy = GenerationType.IDENTITY) @Column(name="AdGroup_Id") public Long getId() { return Id; } public void setId(Long id) { Id = id; } @Column(name="AdGroup_Name") public String getName() { return Name; } public void setName(String name) { Name = name; } @ManyToOne @JoinColumn (name="Cam_ID", nullable = true,insertable = false) public CampaignInterface getCampaign() { return Campaign; } public void setCampaign(CampaignInterface campaign) { this.Campaign = campaign; } } what am i missing?? please look into it ...

    Read the article

  • AS3 URLRequest in for Loop problem

    - by Adrian
    Hi guys, I read some data from a xml file, everything works great besides urls. I can't figure what's the problem with the "navigateURL" function or with the eventListener... on which square I click it opens the last url from the xml file for(var i:Number = 0; i <= gamesInput.game.length() -1; i++) { var square:square_mc = new square_mc(); //xml values var tGame_name:String = gamesInput.game.name.text()[i];//game name var tGame_id:Number = gamesInput.children()[i].attributes()[2].toXMLString();//game id var tGame_thumbnail:String = thumbPath + gamesInput.game.thumbnail.text()[i];//thumb path var tGame_url:String = gamesInput.game.url.text()[i];//game url addChild(square); square.tgname_txt.text = tGame_name; square.tgurl_txt.text = tGame_url; //load & attach game thumb var getThumb:URLRequest = new URLRequest(tGame_thumbnail); var loadThumb:Loader = new Loader(); loadThumb.load(getThumb); square.addChild(loadThumb); // square.y = squareY; square.x = squareX; squareX += square.width + 10; square.buttonMode = true; this.addEventListener(MouseEvent.CLICK, navigateURL); } function navigateURL(event:MouseEvent):void { var url:URLRequest = new URLRequest(tGame_url); navigateToURL(url, "_blank"); trace(tGame_url); } Many thanks!

    Read the article

< Previous Page | 428 429 430 431 432 433 434 435 436 437 438 439  | Next Page >