Search Results

Search found 23474 results on 939 pages for 'xml import'.

Page 433/939 | < Previous Page | 429 430 431 432 433 434 435 436 437 438 439 440 | Next Page >

Exposing headers on iPhone static library

- by leolobato

Hello guys, I've followed this tutorial for setting up a static library with common classes from 3 projects we are working on. It's pretty simple, create a new static library project on xcode, add the code there, a change some headers role from project to public. The tutorial says I should add my library folder to the header search paths recursively. Is this the right way to go? I mean, on my library project, I have files separated in folders like Global/, InfoScreen/, Additions/. I was trying to setup one LOKit.h file on the root folder, and inside that file #import everything I need to expose. So on my host project I don't need to add the folder recursively to the header search path, and would just #import "LOKit.h". But I couldn't get this to work, the host project won't build complaining about all the classes I didn't add to LOKit.h, even though the library project builds. So, my question is, what is the right way of exposing header files when I setup a Cocoa Touch Static Library project on xCode?

Read the article
Pros/cons of reading connection string from physical file vs Application object (ASP.NET)?

- by HaterTot

my ASP.NET application reads an xml file to determine which environment it's currently in (e.g. local, development, production). It checks this file every single time it opens a connection to the database, in order to know which connection string to grab from the Application Settings. I'm entering a phase of development where efficiency is becoming a concern. I don't think it's a good idea to have to read a file on a physical disk ever single time I wish to access the database (very often). I was considering storing the connection string in Application["ConnectionString"]. So the code would be public static string GetConnectionString { if (Application["ConnectionString"] == null) { XmlDocument doc = new XmlDocument(); doc.Load(HttpContext.Current.Request.PhysicalApplicationPath + "bin/ServerEnvironment.xml"); XmlElement xe = (XmlElement) xnl[0]; switch (xe.InnerText.ToString().ToLower()) { case "local": connString = Settings.Default.ConnectionStringLocal; break; case "development": connString = Settings.Default.ConnectionStringDevelopment; break; case "production": connString = Settings.Default.ConnectionStringProduction; break; default: throw new Exception("no connection string defined"); } Application["ConnectionString"] = connString; } return Application["ConnectionString"].ToString(); } I didn't design the application so I figure there must have been a reason for reading the xml file every time (to change settings while the application runs?) I have very little concept of the inner workings here. What are the pros and cons? Do you think I'd see a small performance gain by implementing the function above? THANKS

Read the article
Enable PyGTK Eventbox motion-notify-event while is a Layout child

- by mkotechno

I noticed when a Eventbox is added into a Layout some events are missed, this does not happend for example adding it to a Fixed (very similar widget), I tried to restore the event mask in this way with no sucess: import pygtk import gtk def foo(widget, event): print event pygtk.require('2.0') window = gtk.Window(gtk.WINDOW_TOPLEVEL) window.connect('destroy', lambda x: gtk.main_quit()) eventbox = gtk.EventBox() eventbox.connect('button-press-event', foo) # works eventbox.connect('motion-notify-event', foo) # fail eventbox.set_events( gtk.gdk.BUTTON_MOTION_MASK| # restoring missed masks gtk.gdk.BUTTON1_MOTION_MASK| gtk.gdk.BUTTON2_MOTION_MASK| gtk.gdk.BUTTON3_MOTION_MASK) layout = gtk.Layout() image = gtk.image_new_from_file('/home/me/picture.jpg') layout.add(image) eventbox.add(layout) window.add(eventbox) window.show_all() gtk.main() How should I restore the missed event/mask?

Read the article
AIR:- Desktop Application related to Window Component (Need some work around)

- by Mahesh Parate

Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

Read the article
Java: conditional initialization?

- by HH

Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

Read the article
Multi-part template issue with Jinja2

- by Alan Harris-Reid

Hi, When creating templates I typically have 3 separate parts (header, body, footer) which I combine to pass a singe string to the web-server (CherryPy in this case). My first approach is as follows... from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template('Body.html') page_body = tmpl.render() tmpl = env.get_template('Header.html') page_header = tmpl.render() tmpl = env.get_template('Footer.html') page_footer = tmpl.render() page_code = page_header + page_body + page_footer but this contains repetitious code, so my next approach is... def render_template(html_file): from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template(html_file) return tmpl.render() page_header = render_template('Header.html') page_body = render_template('Body.html') page_footer = render_template('Footer.html) However, this means that each part is created in its own environment - can that be a problem? Are there any other downsides to this approach? I have chosen the 3-part approach over the child-template approach because I think it may be more flexible (and easier to follow), but I might be wrong. Anyone like to convince me that using header, body and footer blocks might be better? Any advice would be appreciated. Alan

Read the article
How to properly close a process with NppExec?

- by Sam the Great

I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

Read the article
pyplot: really slow creating heatmaps

- by cvondrick

I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

Read the article
Identifying that a variable is a new-style class in Python?

- by Dave Johansen

I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

Read the article
read subprocess stdout line by line

- by Caspin

My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

Read the article
nginx error: (99: Cannot assign requested address)

- by k-g-f

I am running Ubuntu Hardy 8.04 and nginx 0.7.65, and when I try starting my nginx server: $ sudo /etc/init.d/nginx start I get the following error: Starting nginx: [emerg]: bind() to IP failed (99: Cannot assign requested address) where "IP" is a placeholder for my IP address. Does anybody know why that error might be happening? This is running on EC2. My nginx.conf file looks like this: user www-data www-data; worker_processes 4; events { worker_connections 1024; } http { include mime.types; default_type application/octet-stream; access_log /usr/local/nginx/logs/access.log; sendfile on; tcp_nopush on; tcp_nodelay on; keepalive_timeout 3; gzip on; gzip_comp_level 2; gzip_proxied any; gzip_types text/plain text/css application/x-javascript text/xml application/xml application/xml+rss text/javascript; include /usr/local/nginx/sites-enabled/*; } and my /usr/local/nginx/sites-enabled/example.com looks like: server { listen IP:80; server_name example.com; rewrite ^/(.*) https://example.com/$1 permanent; } server { listen IP:443 default ssl; ssl on; ssl_certificate /etc/ssl/certs/myssl.crt; ssl_certificate_key /etc/ssl/private/myssl.key; ssl_protocols SSLv3 TLSv1; ssl_ciphers ALL:!ADH:RC4+RSA:+HIGH:+MEDIUM:-LOW:-SSLv2:-EXP; server_name example.com; access_log /home/example/example.com/log/access.log; error_log /home/example/example.com/log/error.log; }

Read the article
jcuda library usage problem

- by user513164

hi m very new to java and Linux i have a code which is taken from examples of jcuda.the code is following import jcuda.CUDA; import jcuda.driver.CUdevprop; import jcuda.driver.types.CUdevice; public class EnumDevices { public static void main(String args[]) { //Init CUDA Driver CUDA cuda = new CUDA(true); int count = cuda.getDeviceCount(); System.out.println("Total number of devices: " + count); for (int i = 0; i < count; i++) { CUdevice dev = cuda.getDevice(i); String name = cuda.getDeviceName(dev); System.out.println("Name: " + name); int version[] = cuda.getDeviceComputeCapability(dev); System.out.println("Version: " + String.format("%d.%d", version[0], version[1])); CUdevprop prop = cuda.getDeviceProperties(dev); System.out.println("Clock rate: " + prop.clockRate + " MHz"); System.out.println("Threads per block: " + prop.maxThreadsPerBlock); } } } I'm using Ubuntu as my operating system i compiled it with following command 1:-javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices i got following error error: Class names, 'EnumDevices', are only accepted if annotation processing is explicitly requested 1 error i don't know what is the meaning of this error.what should i do to compile the program than i changed the compiling option which is javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices.java than i got following error EnumDevices.java:36: clockRate is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Clock rate: " + prop.clockRate + " MHz"); ^ EnumDevices.java:37: maxThreadsPerBlock is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Threads per block: " + prop.maxThreadsPerBlock); ^ 2 errors Now I'm completely confused i don't know what to do? how to compile this program ? how to install the jcuda package or how to use it ? how to use package which have only jar files and .so files and the jar files don't having manifest file ? please help me

Read the article
Converting IPv4 or IPv6 address to a long for comparisons

- by Justin Akehurst

In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

Read the article
Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Read the article
Coldbox Security Interceptor

- by faheem

Hi I am new to coldbox and working on a guestbook messaging forum. does anyone know how I can apply some rule in coldbox to show edit and delete for specified users of admin or user in the edit page. I am not sure how to specify this as I already have my rules here as shown in securityRules.xml: SecurityRules.XML <?xml version="1.0" encoding="UTF-8"?>  <rules> <rule> <whitelist>^entries,ehSecurity\..*,registry\..*</whitelist> <securelist></securelist> <roles>admin</roles> <permissions>read,write</permissions> <redirect>ehSecurity.dspLogin</redirect> </rule> <rule> <whitelist>^entries,ehSecurity\..*,main\..*,^registry</whitelist> <securelist></securelist> <roles>author,admin</roles> <permissions>read</permissions> <redirect>ehSecurity.dspLogin</redirect> </rule> </rules>

Read the article
Flip clock showing time issue (animations invovled)

- by Hwang

I'm creating a flip clock (clock where you always see in airport), but I can't seems to get the time to show at the correct timing. After the flip, then will see the number changing. But I want it to change before it flips. Currently I'm not sure whether is the animation problem, or isit I have to do something else on the script. I've uploaded the FLA so that you could have a look on how I set up the flipping animation. http://www.mediafire.com/?nzmymjgtntz Below is the AS3 code: package { import flash.display.MovieClip; import flash.events.TimerEvent; import flash.utils.Timer; public class flipClock extends MovieClip { private var clock:clockMC=new clockMC(); //seconds private var secTop1=clock.second.top1.digit; private var secTop2=clock.second.top2.digit; private var secBot1=clock.second.bot1.digit; private var secBot2=clock.second.bot2.digit; private var seconds:Number; private var minutes:Number; private var hours:Number; private var days:Number; public function flipClock():void { decrease(); addChild(clock); } private function decrease():void { var countdownTimer:Timer=new Timer(1000); //Adding an event listener to the timer object countdownTimer.addEventListener(TimerEvent.TIMER,updateTime); //Initializing timer object countdownTimer.start(); } private function updateTime(event:TimerEvent):void { decreasTimerFunction(); updateSecond(); //updateMinute(); } private function updateSecond():void { clock.second.play(); secTop1.text=num2; secTop2.text=num1; if (num1<10) { num1="0"+num1; } if (num2<10) { num2="0"+num2; } if (num1==60) { num1=0; } if (num2==60) { num2=0; } secTop1.text=num1; secTop2.text=num2; //secBot1.text=num1; //secBot2.text=num2; } private function decreasTimerFunction():void { //Create a date object for Christmas Morning var endTime:Date=new Date(2010,4,26,0,0,0,0); //Current date object var now:Date=new Date(); // Set the difference between the two date and times in milliseconds var timeDiff:Number=endTime.getTime()-now.getTime(); seconds=Math.floor(timeDiff/1000); minutes=Math.floor(seconds/60); hours=Math.floor(minutes/60); days=Math.floor(hours/24); // Set the remainder of the division vars above hours%=24; minutes%=60; seconds%=60; } } }

Read the article
iPhone: error: request for member 'table' in something not a structure or union

- by Jack Griffiths

Hi there, When it comes to compiling my application, I get the error mentioned in the title. How would I go about remedying this error? Basically, I want to get from one table to the other. Hierarchy, navigation. NextViewController.m #import "RootViewController.h" #import "NextViewController.h" @implementation NextViewController - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Releases the view if it doesn't have a superview // Release anything that's not essential, such as cached data } - (void)dealloc { [super dealloc]; } - (IBAction) changeTable:(NSString *)str{ tblCSS.table = str; } The last line contains the error. If you need any more code, just ask. I'll amend this post with it. Cheers, Jack

Read the article
How to draw the "trail" in a maze solving application

- by snow-spur

Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

Read the article
Rails does not display error messages on a form in a custom method

- by slythic

Hi all, I've created a custom method called checkout in my app. I create an order (which is done my adding products to my "cart"), assign it to my client, and then I head to my checkout screen where I confirm the items and enter their customer order number and complete the order (submit). Everything works great except that it doesn't display error messages. I'm able to display a flash error notice (seen in complete_order method) when things go wrong but it doesn't specify the details like a normal form would. The error messages should appear if the customer order number is not unique for that client. Below is the custom method (checkout) related code. Order Model: validates_uniqueness_of :customer_order_number, :scope => :client_id Orders_controller: def checkout @order = current_order end def complete_order @order = current_order respond_to do |format| if @order.update_attributes(params[:order]) @order.complete #sets submitted datetime and state to 'complete' flash[:notice] = 'Thank you! Your order is being processed.' format.html { redirect_to( products_path ) } format.xml { head :ok } else flash[:error] = 'Please review your items' #added to confirm an error is present format.html { redirect_to( checkout_path ) } format.xml { render :xml => @order.errors, :status => :unprocessable_entity } end end end And the form in the checkout view: <% form_for @order, :url => { :controller => "orders", :action => "complete_order" } do |f| %> <%= f.error_messages %> <%= f.text_field :customer_order_number, :label => "Purchase Order Number" %> <p> <%= f.submit 'Complete Order', :confirm => 'Are you sure?' %> <small> or <%= link_to 'cancel', current_cart_path %></small> </p> <% end %> Any idea how I can display the specific error messages? Thank you in advance! -Tony

Read the article
How can I set controls for a web page ??

- by Rami Jarrar

I have this login page with https, and i reach to this approach:: import ClientForm import urllib2 request = urllib2.Request("http://ritaj.birzeit.edu") response = urllib2.urlopen(request) forms = ClientForms.ParseResponseEx(response) response.close() f = forms[0] username = str(raw_input("Username: ")) password = str(raw_input("Password: ")) ## Here What To Do request2 = form.click() i get the controls of that page >>> f = forms[0] >>> [c.name for c in f.controls] ['q', 'sitesearch', 'sa', 'domains', 'form:mode', 'form:id', '__confirmed_p', '__refreshing_p', 'return_url', 'time', 'token_id', 'hash', 'username', 'password', 'persistent_p', 'formbutton:ok'] so how can i set the username and password controls of the "non-form form" f ??? and i have another problem,, how to know if its the right username and password ??

Read the article
How to get progress bar to time Class exectution

- by chrissygormley

Hello, I am trying to use progress bar to show the progress of a script. I want it increase progress after every function in a class is executed. The code I have tried is below: import progressbar from time import sleep class hello(): def no(self): print 'hello!' def yes(self): print 'No!!!!!!' def pro(): bar = progressbar.ProgressBar(widgets=[progressbar.Bar('=', '[', ']'), ' ', progressbar.Percentage()]) for i in Yep(): bar.update(Yep.i()) sleep(0.1) bar.finish() if __name__ == "__main__": Yep = hello() pro() Does anyone know how to get this working. Thanks

Read the article
Class 'org.springframework.http.converter.ResourceHttpMessageConverter' not found - how to correct?

- by Ash Kim

Eclipse STS is reporting I have problem with my spring project. It's a fresh project generated from the Spring Web MVC Project Template (File-New-Spring Template Project-Spring Web MVC ). When I create the project it has no problems - it's only once I modify the pom (by adding the hibernate dependencies) that STS then picks up the spring problem. Strangely if I revert the pom the problem remains. Also I can run the project on a spring tc server and all works correctly. Any ideas how I can satisfy this problem report? "Class 'org.springframework.http.converter.ResourceHttpMessageConverter' not found" mvc-config.xml /src/main/webapp/WEB-INF/spring line 9 Spring Beans Problem mvc-config.xml: <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:mvc="http://www.springframework.org/schema/mvc" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd"> <mvc:annotation-driven />   <bean class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix" value="/WEB-INF/views/"/> <property name="suffix" value=".jsp"/> </bean> </beans>

Read the article
Importing a spreadsheet into an asp.net program and listing the worksheets

- by Bob Avallone

I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

Read the article
Get tag name and value of a given node using XMLReader, DOM, Xpath

- by rossjha

I need to query an xml document and then display specific tag values, e.g. forename, surname, group(dept), job_title. I'm using XMLReader as i may need to work with large XML files. I using DomXPath to filter the data, but i don't know how to retrieve the nodeName and value for each element. The code below only returns 'member' as the node name? Any help would be appreciated. <?php $reader = new XMLReader(); $reader->open('include/staff.xml'); while ($reader->read()){ switch($reader->nodeType){ case(XMLREADER::ELEMENT): if($reader->localName === 'staff'){ $node = $reader->expand(); $dom = new DomDocument(); $dom->formatOutput = true; $n = $dom->importNode($node, true); $dom->appendChild($n); $xp = new DomXpath($dom); $res = $xp->query("/staff/member[groups='HR']"); } } } echo $res->item(0)->nodeName; echo $res->item(0)->nodeValue; ?>

Read the article
How to use less memory while running a task in Symfony 1.4?

- by Guillaume Flandre

I'm using Symfony 1.4 and Doctrine. So far I had no problem running tasks with Symfony. But now that I have to import a pretty big amount of data and save them in the database, I get the infamous "Fatal Error: Allowed memory size of XXXX bytes exhausted" During this import I'm only creating new objects, setting a few fields and saving them. I'm pretty sure it has something to do with the number of objects I'm creating when saving data. Unsetting those objects doesn't do anything though. Are there any best practices to limit memory usage in Symfony?

Read the article

< Previous Page | 429 430 431 432 433 434 435 436 437 438 439 440 | Next Page >