Search Results

Search found 15007 results on 601 pages for 'array'.

Page 442/601 | < Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >

  • Rails route, show all elements on the same page

    - by Igor Oliveira Antonio
    I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Stackoverflow Flair Facebook app error

    - by emre
    Just to lewt you know, what happened when I allowed the app in FB Fatal error: Uncaught exception 'FacebookRestClientException' with message 'Param assoc_time must be a number' in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php:2878 Stack trace: #0 /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php(2544): FacebookRestClient-call_method('facebook.data.s...', Array) #1 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(188): FacebookRestClient-data_setAssociation('uid_so_uid2', '616867493', '5004213880486') #2 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(208): setSoUID('616867493', -1, Object(Facebook)) #3 /home/content/r/e/j/rejun2000/html/fb_so/index.php(26): updateProfileBox('616867493', -1, Object(Facebook)) #4 {main} thrown in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php on line 2878

    Read the article

  • How do I include 2 tables in one LocalStorage item?

    - by Noor
    I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

    Read the article

  • How to GetGuiResources for all system processes?

    - by Krzysztof
    Hello, I need to measure all used GDI objects in a Windows xp system. I found a GetGuiResources(__in HANDLE hProcess, __in DWORD uiFlags) method (with the GR_GDIOBJECTS flag). I call it for the process which I get from the method GetCurrentProcess() defined in WinBase.h. I don't know how to call it for other system processes, which I get by System::Diagnostics::Process::GetProcesses(), because that function returns an array of Process pointers, and GetGuiResources takes a HANDLE. Does anybody know a solution for that? How can I transform Process pointer to a Handle or get HANDLEs for all running system processes? thanks for help in advance!

    Read the article

  • Inserting multiple types into an SQLite database with Python

    - by mankoff
    I'm trying to create an SQLite 3 database from Python. I have a few types I'd like to insert into each record: A float, and then 3 groups of n floats, currently a tuple but could be an array or list.. I'm not well-enough versed in Python to understand all the differences. My problem is the INSERT statement. DAS = 12345 lats = (42,43,44,45) lons = (10,11,12,13) times = (1,2,3,4,5,6,7,8,9) import sqlite3 connection = sqlite3.connect("test.db") cursor = connection.cursor() cursor.execute( "create table foo(DAS LONG PRIMARY KEY,lats real(4),lons real(4), times real(9) )" ) I'm not sure what comes next. Something along the lines of: cmd = 'INSERT into foo values (?,?,?,?), ..." cursor.execute(cmd) How should I best build the SQL insert command given this data?

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Node.js mongoose: how to use the .in and .sort methods of a query?

    - by Chris
    Hi there, I'm trying to wrap my head around mongoose, but I'm having a hard time finding any kind of documentation for some of the more advanced query options, specifically the .in and .sort methods. What's the syntax for sorting, for example, a Person by age? db.model("Person").find().sort(???).all(function(people) { }); Then, let's say I want to find a Movie based on a genre, where a Movie can have many genres (in this case, an array of strings). Presumably, I'd use the .in function to accomplish that, but I'm not sure what the syntax would be. Or perhaps I don't have to use the .in method at all...? Either way, I'm lost. db.model("Movie").find().in(???).all(function(movies) { }); Anyone have any ideas? Or even better, a link to some comprehensive documentation? Thanks! Chris

    Read the article

  • $.(ajax) wrapper for Jquery - passing parameters to delegates

    - by gnomixa
    I use $.(ajax) function extensively in my app to call ASP.net web services. I would like to write a wrapper in order to centralize all the ajax calls. I found few simple solutions, but none address an issue of passing parameters to delegates, for example, if i have: $.ajax({ type: "POST", url: "http://localhost/TemplateWebService/TemplateWebService/Service.asmx/GetFoobar", data: jsonText, contentType: "application/json; charset=utf-8", dataType: "json", success: function(response) { var results = (typeof response.d) == 'string' ? eval('(' + response.d + ')') : response.d; OnSuccess(results, someOtherParam1, someOtherParam2); }, error: function(xhr, status, error) { OnError(); } }); The wrapper to this call would have to have the way to pass someOtherParam1, someOtherParam2 to the OnSuccess delegate...Aside from packing the variables into a generic array, I can't think of other solutions. How did you guys address this issue?

    Read the article

  • http_post_data basic authentication?

    - by kristian nissen
    I have a remote service that I need to access, according to the documentation it's restricted using basic authentication and all requests have to be posted (HTTP POST). The documentation contains this code example - VB script: Private Function SendRequest(ByVal Url, ByVal Username, ByVal Password, ByVal Request) Dim XmlHttp Set XmlHttp = CreateObject("MSXML2.XmlHttp") XmlHttp.Open "POST", Url, False, Username, Password XmlHttp.SetRequestHeader "Content-Type", "text/xml" XmlHttp.Send Request Set SendRequest = XmlHttp End Function how can I accomplish this in PHP? When I post data to the remote server it replies: 401 Unauthorized Access which is fine because I'm not posting my user/pass just the data. Bu when I add my user/pass as it's describe here: http://dk.php.net/manual/en/http.request.options.php like this: $res = http_post_data('https://example.com', $data, array( 'Content-Type: "text/xml"', 'httpauth' => base64_encode('user:pass'), 'httpauthtype' => HTTP_AUTH_BASIC ) ); the protocol is https - I get a runtime error in return (it's a .Net service). I have tried it without the base64_encode but with the same result.

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • Zend Regex Route > Track the api version

    - by dskanth
    Hi, i am building a web service with zend and i am using modules to separate my api versions. Ex: "applications/modules/v1/controllers", "applications/modules/v2/controllers" have different set of actions and functionality. I have made "v1" as the default module in "application.ini" file: resources.modules = "" resources.frontController.defaultModule = "v1" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.moduleControllerDirectoryName = "controllers" I have written the following in my bootstrap file: $router = $front->getRouter(); $r1 = new Zend_Controller_Router_Route_Regex('api/v1/tags.xml', array('module' => 'v1', 'controller' => 'tags', 'action' => 'index')); $router->addRoute('route1', $r1); Suppose, if this is my url: http://localhost/api/v1/tags.xml then it belongs to version 1 (v1). But i dont want to write many routes like this one, so i want to know how can i track the version from the regex url and dynamically determine the api version to be used (1 or 2).

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • Estimate serialization size of objects?

    - by Stefan K.
    In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

    Read the article

  • Creating a proper CMS thoughts

    - by dallasclark
    I'm just about to expand the functionality of our own CMS but was thinking of restructuring the database to make it simpler to add/edit data types and values. Currently, the CMS is quite flat - the CMS requires a field in the database for every type of stored value. The first option that comes to mind is simply a table which keeps the data types (ie: Address 1, Suburb, Email Address etc) and another table which holds values for each of these data types. Just like how Wordpress keeps values in the 'options' table, serialize would be used to store an array of values. The second option is how Drupal works, the CMS creates tables for every data type. Unlike Wordpress, this can be a bit of an overkill but really useful for SQL queries when ordering and grouping by a particular value. What's everyone's thoughts?

    Read the article

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

    - by jphenow
    I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

    Read the article

  • [wxWidgets] How to store wxImage into database, using C++?

    - by Thomas Matthews
    I have some wxImages and I would like to store them into a BLOB (Binary Large OBject) field in a MySQL database. There are no methods in wxImage nor wxBitmap for obtaining the binary data as an array of unsigned char so I can load into the database. My current workaround is to write the image to a temporary file, then load the BLOB field directly from the file. Is there a more efficient method to load and store a wxImage object into a MySQL BLOB field? I am using MySql C++ connector 1.05, MS Visual Studio 2008, wxWidgets and C++.

    Read the article

  • A controller problem using a base CRUD model

    - by rkj
    In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

    Read the article

  • runtime loading of ValidateAntiForgeryToken Salt value

    - by p.campbell
    Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Sales figures not displayed in form

    - by Brian Wilson
    Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

    Read the article

  • .NET Regular expressions on bytes instead of chars

    - by brickner
    Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

    Read the article

  • rails update whole index of a model with one click

    - by mattherick
    hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

    Read the article

  • How to get nearby POIs

    - by balexandre
    I have a database with Points of Interest that all have an address. I want to know what is the method/name/call to get all nearby POIs from a given position. I understand that I need to convert all my addresses to LAT / LON coordinates at least, but my question is: for a given LAT / LONG how do I get from the database/array what POIs are nearby by distance, for example: You are here 0,0 nearest POIs in a 2km radius are: POI A (at 1.1 Km) POI C (at 1.3 Km) POI F (at 1.9 Km) I have no idea what should I look into to get what I want :-( Any help is greatly appreciated. Thank you

    Read the article

< Previous Page | 438 439 440 441 442 443 444 445 446 447 448 449  | Next Page >