Search Results

Search found 15059 results on 603 pages for 'associative array'.

Page 444/603 | < Previous Page | 440 441 442 443 444 445 446 447 448 449 450 451  | Next Page >

  • F#: Define an abstract class that inherits an infterface, but does not implement it

    - by akaphenom
    I owuld like to define an abstract class that inerhits from UserControl and my own Interface IUriProvider, but doesn't implement it. The goal is to be able to define pages (for silverlight) that implement UserControl but also provide their own Uri's (and then stick them in a list / array and deal with them as a set: type IUriProvider = interface abstract member uriString: String ; abstract member Uri : unit -> System.Uri ; end type UriUserControl() as this = inherit IUriProvider with abstract member uriString: String ; inherit UserControl() Also the Uri in the definition - I would like to implement as a property getter - and am having issues with that as well. this does not compile type IUriProvider = interface abstract member uriString: String with get; end Thank you...

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Best way to parse command line arguments in C#

    - by Paul Stovell
    When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • Multiple key/value pairs in HTTP POST where key is the same name

    - by randombits
    I'm working on an API that accepts data from remote clients, some of which where the key in an HTTP POST almost functions as an array. In english what this means is say I have a resource on my server called "class". A class in this sense, is the type a student sits in and a teacher educates in. When the user submits an HTTP POST to create a new class for their application, a lot of the key value pairs look like: student_name: Bob Smith student_name: Jane Smith student_name: Chris Smith What's the best way to handle this on both the client side (let's say the client is cURL or ActiveResource, whatever..) and what's a decent way of handling this on the server-side if my server is a Ruby on Rails app? Need a way to allow for multiple keys with the same name and without any namespace clashing or loss of data.

    Read the article

  • Sending POST variables through a PHP proxy for AJAX?

    - by b. e. hollenbeck
    I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

    Read the article

  • Replacing backslash with another symbol in PHP

    - by Skyfe
    Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • Routing configuration in cakephp

    - by ShiVik
    Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

    Read the article

  • Detecting a url using preg_match? without http:// in the string

    - by Stefan
    Hey there, I was wondering how I could check a string broken into an array against a preg_match to see if it started with www. I already have one that check for http://www. $stringToArray = explode(" ",$_POST['text']); foreach($stringToArray as $key=>$val){ $urlvalid = isValidURL($val); if($urlvalid){ $_SESSION["messages"][] = "NO URLS ALLOWED!"; header("Location: http://www.domain.com/post/id/".$_POST['postID']); exit(); } } Thanks! Stefan

    Read the article

  • CodePlex Daily Summary for Sunday, January 30, 2011

    CodePlex Daily Summary for Sunday, January 30, 2011Popular ReleasesWPF Application Framework (WAF): WPF Application Framework (WAF) 2.0.0.3: Version: 2.0.0.3 (Milestone 3): This release contains the source code of the WPF Application Framework (WAF) and the sample applications. Requirements .NET Framework 4.0 (The package contains a solution file for Visual Studio 2010) The unit test projects require Visual Studio 2010 Professional Remark The sample applications are using Microsoft’s IoC container MEF. However, the WPF Application Framework (WAF) doesn’t force you to use the same IoC container in your application. You can use ...Rawr: Rawr 4.0.17 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 and on the Version Notes page: http://rawr.codeplex.com/wikipage?title=VersionNotes As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you...VivoSocial: VivoSocial 7.4.2: Version 7.4.2 of VivoSocial has been released. If you experienced any issues with the previous version, please update your modules to the 7.4.2 release and see if they persist. If you have any questions about this release, please post them in our Support forums. If you are experiencing a bug or would like to request a new feature, please submit it to our issue tracker. Web Controls * Updated Business Objects and added a new SQL Data Provider File. Groups * Fixed a security issue whe...PHP Manager for IIS: PHP Manager 1.1.1 for IIS 7: This is a minor release of PHP Manager for IIS 7. It contains all the functionality available in 56962 plus several bug fixes (see change list for more details). Also, this release includes Russian language support. SHA1 codes for the downloads are: PHPManagerForIIS-1.1.0-x86.msi - 6570B4A8AC8B5B776171C2BA0572C190F0900DE2 PHPManagerForIIS-1.1.0-x64.msi - 12EDE004EFEE57282EF11A8BAD1DC1ADFD66A654VFPX: VFP2C32 2.0.0.8 Release Candidate: This release includes several bugfixes, new functions and finally a CHM help file for the complete library.EnhSim: EnhSim 2.3.3 ALPHA: 2.3.3 ALPHAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 - Added back in a p...DB>doc for Microsoft SQL Server: 1.0.0.0: Initial release Supported output HTML WikiPlex markup Raw XML Supported objects Tables Primary Keys Foreign Keys ViewsmojoPortal: 2.3.6.1: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2361-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Office Web.UI: Alpha preview: This is the first alpha release. Very exciting moment... This download is just the demo application : "Contoso backoffice Web App". No source included for the moment, just the app, for testing purposes and for feedbacks !! This package includes a set of official MS Office icons (143 png 16x16 and 132 png 32x32) to really make a great app ! Please rate and give feedback ThanksParallel Programming with Microsoft Visual C++: Drop 6 - Chapters 4 and 5: This is Drop 6. It includes: Drafts of the Preface, Introduction, Chapters 2-7, Appendix B & C and the glossary Sample code for chapters 2-7 and Appendix A & B. The new material we'd like feedback on is: Chapter 4 - Parallel Aggregation Chapter 5 - Futures The source code requires Visual Studio 2010 in order to run. There is a known bug in the A-Dash sample when the user attempts to cancel a parallel calculation. We are working to fix this.Catel - WPF and Silverlight MVVM library: 1.1: (+) Styles can now be changed dynamically, see Examples application for a how-to (+) ViewModelBase class now have a constructor that allows services injection (+) ViewModelBase services can now be configured by IoC (via Microsoft.Unity) (+) All ViewModelBase services now have a unit test implementation (+) Added IProcessService to run processes from a viewmodel with directly using the process class (which makes it easier to unit test view models) (*) If the HasErrors property of DataObjec...NodeXL: Network Overview, Discovery and Exploration for Excel: NodeXL Excel Template, version 1.0.1.160: The NodeXL Excel template displays a network graph using edge and vertex lists stored in an Excel 2007 or Excel 2010 workbook. What's NewThis release improves NodeXL's Twitter and Pajek features. See the Complete NodeXL Release History for details. Installation StepsFollow these steps to install and use the template: Download the Zip file. Unzip it into any folder. Use WinZip or a similar program, or just right-click the Zip file in Windows Explorer and select "Extract All." Close Ex...Kooboo CMS: Kooboo CMS 3.0 CTP: Files in this downloadkooboo_CMS.zip: The kooboo application files Content_DBProvider.zip: Additional content database implementation of MSSQL, RavenDB and SQLCE. Default is XML based database. To use them, copy the related dlls into web root bin folder and remove old content provider dlls. Content provider has the name like "Kooboo.CMS.Content.Persistence.SQLServer.dll" View_Engines.zip: Supports of Razor, webform and NVelocity view engine. Copy the dlls into web root bin folder to enable...UOB & ME: UOB ME 2.6: UOB ME 2.6????: ???? V1.0: ???? V1.0 ??Password Generator: 2.2: Parallel password generation Password strength calculation ( Same method used by Microsoft here : https://www.microsoft.com/protect/fraud/passwords/checker.aspx ) Minor code refactoringVisual Studio 2010 Architecture Tooling Guidance: Spanish - Architecture Guidance: Francisco Fagas http://geeks.ms/blogs/ffagas, Microsoft Most Valuable Professional (MVP), localized the Visual Studio 2010 Quick Reference Guidance for the Spanish communities, based on http://vsarchitectureguide.codeplex.com/releases/view/47828. Release Notes The guidance is available in a xps-only (default) or complete package. The complete package contains the files in xps, pdf and Office 2007 formats. 2011-01-24 Publish version 1.0 of the Spanish localized bits.ASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.6.2: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager the html generation has been optimized, the html page size is much smaller nowFacebook Graph Toolkit: Facebook Graph Toolkit 0.6: new Facebook Graph objects: Application, Page, Post, Comment Improved Intellisense documentation new Graph Api connections: albums, photos, posts, feed, home, friends JSON Toolkit upgraded to version 0.9 (beta release) with bug fixes and new features bug fixed: error when handling empty JSON arrays bug fixed: error when handling JSON array with square or large brackets in the message bug fixed: error when handling JSON obejcts with double quotation in the message bug fixed: erro...Microsoft All-In-One Code Framework: Visual Studio 2008 Code Samples 2011-01-23: Code samples for Visual Studio 2008New ProjectsAnaida - WebSocket Client/Adapter: Anaida is a WebSocket Client Library/Adapter. With 3 versions for Java, Silverlight and C#CutPasteAssign: Visual Studio extension to assist in the common refactoring of assigning parameters to local variables.Drori Photos: Photos of Drori the photographerD-Solution: App de D-SolutionEnigma Home Inventory: Most consumers do not have an itemized list of proof of ownership. Enigma Home Inventory may take the hassle out of arguing with the insurance companies. This project is aimed to be for a simple inventory program for end users who are not computer savvy.FastKnow: is a CMS & wikiFileSignatures: FileSignatures aims to create a class library that can identify the file format based on file contents. The project is written in C# 3.0, and can be used in .NET 3.5 and 4.0 projects.Genrsis: The aim of the Genrsis project is to be a suite of products that you can use to build things, starting with a workflow-based project management tool. Built in C#, it should be a one-stop place to get well-integrated products to get you up and running.MVC Demos: MVC 2 and MVC 3 examples with ajax and json.MVC Templates for DevExpress: Scaffolding templates for use in ASP.NET MVC 2 with DevExpress MVC Extensions for ASP.NET MVCPixel Replacer: The Pixel Replacer is a simple library for replacing pixel colors with a new color, by setting a filter rule.ReviewPal - The Code Review Companion for .Net.: ReviewPal, the Code Review Companion for .Net. This is an Add-In / Extension for Visual Studio 2008 & Visual Studio 2010. The aim of the Add-In / Extension is to do a source code review within the Visual Studio IDE where code makes more sense and most readable.SMVector3: Vector3 class implemented as float array or with SIMD instructions with the same interface so it is transparant whether you decide to use one version or another. You can also chance version during the life cycle of the projects.uRibbon - Office 2007 Ribbon control for VB.NET: Office 2007 ribbon control, with Orb and graphic transitions. After searching for many day looking for an Office 2007-like ribbon bar, I finally gave up and decided to write my own. It's in decent shape as-is. But anyone interested in helping me to continue the devlopment??vtcheck: This will read a target binary and check to see if it is detected by VirusTotal.Web Scheduled Task Framework: A simple set of classes intended to allow the standalone scheduling of tasks (arbitrary code to execute) on a .net website without requiring access to the operating system.WP7 codeproject app: A Windows Phone 7 app for browsing codeproject.com.zhongjh: ?????????,???????。???????????: ???????????

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Sales figures not displayed in form

    - by Brian Wilson
    Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

    Read the article

  • Help needed with Javascript Variable Scope / OOP and Call Back Functions

    - by gargantaun
    I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

    Read the article

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • How to get ouput from expect

    - by Mallikarjunarao
    i wrote a script for spawing the bc command package require Expect proc bc {eq} { spawn e:/GnuWin32/bc/bin/bc send "$eq\r" expect -re "(.*)\r" return "$expect_out(0,string)" } set foo "9487294387234/sqrt(394872394879847293847)" puts "the valule [bc $foo]" how to get the output from this. When i am running this one i get ouput like this bc 1.06 Copyright 1991-1994, 1997, 1998, 2000 Free Software Foundation, Inc. This is free software with ABSOLUTELY NO WARRANTY. For details type `warranty'. 9487294387234/sqrt(394872394879847293847) 477 can't read "expect_out(0,string)": no such element in array while executing "return "The values is $expect_out(0,string)"" (procedure "bc" line 6) invoked from within "bc $foo" invoked from within "puts "the valule [bc $foo]"" (file "bc.tcl" line 21) how to resolve this one.

    Read the article

  • runtime loading of ValidateAntiForgeryToken Salt value

    - by p.campbell
    Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

    Read the article

  • (External) Java library for creating Tree structure ?

    - by suVasH.....
    I am planning to implement a tree structure where every node has two children and a parent along with various other node properties (and I'd want to do this in Java ) Now, the way to it probably is to create the node such that it links to other nodes ( linked list trick ), but I was wondering if there is any good external library to handle all this low level stuff. ( for eg. the ease of stl::vector vs array in C++ ). I've heard of JDots, but still since i haven't started (and haven't programmed a lot in Java), I'd rather hear out before I begin.

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • $.(ajax) wrapper for Jquery - passing parameters to delegates

    - by gnomixa
    I use $.(ajax) function extensively in my app to call ASP.net web services. I would like to write a wrapper in order to centralize all the ajax calls. I found few simple solutions, but none address an issue of passing parameters to delegates, for example, if i have: $.ajax({ type: "POST", url: "http://localhost/TemplateWebService/TemplateWebService/Service.asmx/GetFoobar", data: jsonText, contentType: "application/json; charset=utf-8", dataType: "json", success: function(response) { var results = (typeof response.d) == 'string' ? eval('(' + response.d + ')') : response.d; OnSuccess(results, someOtherParam1, someOtherParam2); }, error: function(xhr, status, error) { OnError(); } }); The wrapper to this call would have to have the way to pass someOtherParam1, someOtherParam2 to the OnSuccess delegate...Aside from packing the variables into a generic array, I can't think of other solutions. How did you guys address this issue?

    Read the article

  • Output to jTextArea in realtime

    - by Robert
    I have some code which takes a few minutes to process, it has to connect to the web for each string in a long array, each string is a url. I want to make it so that everytime it connects, it should refresh the jtextarea so that the user is not staring into a blank page that looks frozen for 20 min. or however long it takes. here is an example of something i tried and didnt work: try { ArrayList<String> myLinks = LinkParser.getmyLinksArray(jTextArea1.getText()); for (String s : myLinks) { jTextArea2.append(LinkChecker.checkFileStatus(s) + "\n"); } } catch (IOException ex) { JOptionPane.showMessageDialog(jTextArea1, "Parsing Error", "Parsing Error", JOptionPane.ERROR_MESSAGE); Logger.getLogger(MYView.class.getName()).log(Level.SEVERE, null, ex); }

    Read the article

  • PHP anonymous functions scope question

    - by Dan
    Hi, I'm trying to sort an array of objects by a common property, however I cannot get my $property parameter to register in the inner function (I can use it in the outer one OK). The way I read the documentation, it sounded like the parameter would be available, have I misunderstood something? Here is what I have: public static function sortObjectsByProperty($objects, $property) { function compare_object($a, $b) { $a = $a->$property; $b = $b->$property; if ($a->$property == $b->$property) { return 0; } return ($a->$property > $b->$property) ? +1 : -1; } usort($objects, 'compare_object'); return $objects; } Any advice appreciated. Thanks.

    Read the article

  • Estimate serialization size of objects?

    - by Stefan K.
    In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

    Read the article

< Previous Page | 440 441 442 443 444 445 446 447 448 449 450 451  | Next Page >