Search Results

Search found 15059 results on 603 pages for 'associative array'.

Page 449/603 | < Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >

  • OOP function and if statement

    - by Luke
    Not sure if I can ask two questions? If i run the following function in my database class function generateUserArray() { $u = array(); $result = $this->selectAllUsers(); while( $row=mysql_fetch_assoc($result)) { $u[] = $row['username']; } return $u; } Would i call it like this? $u[] = $datebase->generateUserArray(); My second question, will this work: else if($database->addLeagueInformation($subname, $subformat, $subgame, $subseason, $subwindow, $subadmin, $subchampion, $subtype) && $databases->addLeagueTable($name) && $_SESSION['players'] == $subplayers && $comp_name = "$format_$game_$name_$season" && $_SESSION['comp_name'] = $comp_name) Thankyou

    Read the article

  • Statement hierarchy in programming languages

    - by sudo
    I quickly wrote an interpreter for some sort of experimental programing language i came up with, in PHP (yes, in PHP). The language itself doesn't have anything really special, I just wanted to give it a try. I got the basic things working (Hello World, input to output, string manipulation, arithmetics) but I'm getting stuck with the management of blocks and grouped statements. What I mean is: PHP and most other languages let you do this: ((2+2)*(8+2)+2), of course not only with mathematical computations. My program structure currently consists of a multidimensional array built like this: ID => Type (Identifier, String, Int, Newline, EOF, Comma, ...) Contents (If identifier, int or string) How could I allow statements to be executed in a defined order like in the PHP example above?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • CodeIgniter's Scaffolding not working

    - by 01010011
    Hi, I keep getting a 404 Page Not Found whenever I try to access CodeIgniter's Scaffolding page in my browser, like so: localhost/codeignitor/index.php/blog/scaffolding/mysecretword I can access localhost/codeignitor/index.php/blog just fine. I followed CodeIgnitor's instructions in their "Create a blog in 20 minutes" by storing my database settings in the database.php file; and automatically connecting to the database by inserting "database" in the core array of the autoload.php; and I've added both parent::Controller(); and $this-load-scaffolding('myTableName') to blog's constructor. It still gives me this 404. Any suggestions?

    Read the article

  • Setting Mnemonics and Hot Keys for a JOptionPane Dialog

    - by Daniel Bingham
    Is it possible to assign hotkeys and mnemonics to the buttons in a JOptionPane Dialog? I'd like to be able, in a JOptionPane generated message dialog with the options Yes, No and Cancel, press Y to hit the Yes button, N to hit the No button and escape to activate the escape button. Similarly in a dialog with Okay and Cancel buttons I'd like to be able to activate them with enter and escape. I've attempted passing JButtons into the JOptionPane's button Object array with the Mnemonics set already. The mnemonics work and the buttons show up correctly in the dialogs, however, they do not act properly when they are activated. Most noticeably they do not dispose of the dialog. What is the correct way to add hotkeys and Mnemonics to a JOptionPane Dialog's buttons? As always, my apologies ahead of time if this is a duplicate - I searched both Google and Stackoverflow and found nothing.

    Read the article

  • Is NSDictionary key order guaranteed the same as initialized if it never changes?

    - by Thaurin
    I've run into the same problem as found in this question. However, I have a follow-up question. I seem to be in the same situation as the original asker: I have a plist with a hierarchy of dictionaries that define a configuration screen. These are not mutable and will stay the same throughout the application. Since the original discussion seems to focus on problems arising from mutating the dictionary, I must ask for comfirmation: is the order of a dictionary guaranteed the same as they are in the plist, i.e. as it is read (with initWithContentsOfFile)? Can I use allKeys on it in this case to get a correct-order array of keys if the dictionary never changes?

    Read the article

  • what is for....in statement in javascript

    - by dramasea
    anyone can explain how to use for...in statement in javascript. I had read the w3school article but i think it is not so clear.Below is the code, please explain this: <html> <body> <script type="text/javascript"> var x; var mycars = new Array(); mycars[10] = "Saab"; mycars[20] = "Volvo"; mycars[30] = "BMW"; for (x in mycars) { document.write(mycars[x] + "<br />"); } </script> </body> </html>

    Read the article

  • Regular expression for parsing CSV in PHP

    - by Discodancer
    I already managed to split the CSV file using this regex: "/,(?=(?:[^\"]\"[^\"]\")(?![^\"]\"))/" But I ended up with an array of strings that contain the opening and ending double quotes. Now I need a regex that would strip those strings of the delimiter double quotes. As far as I know the CSV format can encapsulate strings in double quotes, and all the double quotes that are already a part of the string are doubled. For example: My "other" cat becomes "My ""other"" cat" What I basically need is a regex that will replace all sequences of N doublequotes with a sequence of (N/2 - rounded down) double quotes. Or is there a better way ? Thanks in advance.

    Read the article

  • Routing zend request through a default controller when controller not found.

    - by Brett Pontarelli
    Below is a function defined in my Bootstrap class. I must be missing something fundamental in the way Zend does routing and dispatching. What I am trying to accomplish is simple: For any request /foo/bar/* that is not dispatchable for any reason try /index/foo/bar/. The problem I'm having is when the FooController exists I get Action "foo" does not exist. Basically, the isDispatchable is always false. public function run() { $front = Zend_Controller_Front::getInstance(); $request = $front->getRequest(); $dispatcher = $front->getDispatcher(); //$controller = $dispatcher->getControllerClass($request); if (!$dispatcher->isDispatchable($request)) { $route = new Zend_Controller_Router_Route( ':action/*', array('controller' => 'index') ); $router = $front->getRouter(); $router->addRoute('FallBack', $route); } $front->dispatch(); }

    Read the article

  • SQL Server 2005 Fail: Return Dates As Strings

    - by Abs
    Hello all, I am using the SQL Server PHP Driver, I think this question can be answered without knowing what this is. I have come across this many times, what does it mean by NAMES? Column names?: SET NAMES utf8 Is there a query similar to the above that will get my dates to be returned as a string? For some reason on my SQL Sever 2008 on Vista, this works: $connectionInfo = array('Database' => $dbname, 'ReturnDatesAsStrings' => true) But the above 'ReturnDatesAsStrings' does not work on my SQL Server 2005 on a windows server machine? I can't execute any queries after setting the above! Does SQL Server 2005 support ReturnDatesAsStrings? Is there some other parameter I can pass to do the same? Thanks all for any help EDIT I should of mentioned this but if there is a solution I am hoping for one that is in the form of a setting that can be set before any queries can be executed as I do not have control on what queries will be executed.

    Read the article

  • Pear MDB2 class and raiserror exceptions in SQL Server

    - by drholzmichl
    Hi, in SQL Server it's possible to raise an error with raiserror(). I want to use a severity, which doesn't interrupt the connection. This error is raised in a stored procedure. In SQL Management Studio all is fine and I get my error code when executing this SP. But when trying to execute this SP via MDB2 in PHP5 this doesn't work. All I get is an empty array. MDB2 object is created via (including needed options): $db =& MDB2::connect($dsn); $db->setFetchMode(MDB2_FETCHMODE_ASSOC); $db->setOption('portability',MDB2_PORTABILITY_ALL ^ MDB2_PORTABILITY_EMPTY_TO_NULL); The following works (I get a PEAR error): $db->query("RAISERROR('test',11,0);"); But when calling a stored procedure which raises this error via $db->query("EXEC sp_raise_error"); there is not output. What's wrong?

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Difference between two commands of fetching Shopping Cart Items in Magento

    - by Knowledge Craving
    In Magento, if you need to get / fetch the Shopping Cart's Item details, you can do it in any of the two possible ways, which will provide you with all the shopped Items in an array:- $cartItems1 = $cart->getQuote()->getAllItems(); $cartItems2 = $cart->getItems()->getData(); But before using any one of the above two methods, you need to initialize the shopping cart object as:- $cart = new Mage_Checkout_Model_Cart(); $cart->init(); Can anyone please describe in details as to what the two options provide & their differences between each other, along with their possible usage. In any more such option is available in Magento, can anyone please highlight it?

    Read the article

  • C++ Microsoft SAPI: How to set Windows text-to-speech output to a memory buffer?

    - by Vladimir
    Hi all, I have been trying to figure out how to "speak" a text into a memory buffer using Windows SAPI 5.1 but so far no success, even though it seems it should be quite simple. There is an example of streaming the synthesized speech into a .wav file, but no examples of how to stream it to a memory buffer. In the end I need to have the synthesized speech in a char* array in 16 kHz 16-bit little-endian PCM format. Currently I create a temp .wav file, redirect speech output there, then read it, but it seems to be a rather stupid solution. Anyone knows how to do that? Thanks!

    Read the article

  • Dynamic programming: Find largest diamond (rhombus)

    - by Darksody
    I have a small program to do in Java. I have a 2D array filled with 0 and 1, and I must find the largest rhombus (as in square rotated by 90 degrees) and their numbers. Example: 0 1 0 0 0 1 1 0 1 1 1 0 1 0 1 1 1 1 0 1 1 1 1 1 0 0 1 1 1 1 1 1 1 1 1 1 Result: 1 1 1 1 1 1 1 1 1 1 1 1 1 The problem is similar to this SO question. If you have any idea, post it here.

    Read the article

  • Regular Expression - capturing contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

  • PHP pathinfo gets fooled by url in quert string. Any workaround?

    - by Majid
    I am working on a small function to take in a url and return a relative path based on where it resides itself. If the url contains a path in the query string, pathinfo returns incorrect results. This is demonstrated by the code below: $p = 'http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt'; $my_path_info = pathinfo($p); echo $p . '<br/><pre>'; print_r($my_path_info); echo '</pre>'; That code outputs: http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt Array ( [dirname] => http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir [basename] => afile.txt [extension] => txt [filename] => afile ) Which obviously is wrong. Any workaround?

    Read the article

  • Checking for Magento login on external page

    - by LinuxGnut
    I'm hitting a wall here while trying to access items from Magento on an external page (same server, same domain, etc, etc). I want to see if the user is logged into Magento before showing them certain parts on the site. Keep in mind that this code exists outside of Magento. Mage::app("default"); Mage::getSingleton("core/session", array("name" = "frontend")); if (empty($session)) { $session = Mage::getSingleton("customer/session"); } if($session-isLoggedIn()) echo "hi"; $cart = Mage::helper('checkout/cart')-getCart()-getItemsCount(); echo $cart; $cart returns 0, where I definitely have products in my cart. isLoggedIn() also returns false. What am I doing wrong here? Is there an option in Magento that I need to turn on or off to be able to access this information outside of Magento?

    Read the article

  • Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

    - by jtolle
    I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

    Read the article

  • Codeigniter Form validation problem

    - by ben robinson
    Please please please can someone help me $this-load-library('form_validation'); $this-load-helper('cookie'); $data = array(); if($_POST) { // Set validation rules including additional validation for uniqueness $this-form_validation-set_rules('yourname', 'Your Name', 'trim|required'); $this-form_validation-set_rules('youremail', 'Your Email', 'trim|required|valid_email'); $this-form_validation-set_rules('friendname', 'Friends Name', 'trim|required'); $this-form_validation-set_rules('friendemail', 'Friends Email', 'trim|required|valid_email'); // Run the validation and take action if($this-form_validation-run()) { echo 'valid; } } else{ echo 'problem'; } Form validation is coming back with no errors can cany one see why?

    Read the article

  • google search engine api not produce exact live search

    - by Bharanikumar
    Hi , The google search engine api not render the first result , Example, function google_search_api($args, $referer = 'http://localhost/test/', $endpoint = 'web'){ $url = "http://ajax.googleapis.com/ajax/services/search/".$endpoint; if ( !array_key_exists('v', $args) ) $args['v'] = '1.0'; $url .= '?'.http_build_query($args, '', '&'); $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $url); curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1); // note that the referer must be set curl_setopt($ch, CURLOPT_REFERER, $referer); $body = curl_exec($ch); curl_close($ch); //decode and return the response return json_decode($body); } $rez = google_search_api(array( 'q' = 'dl03', )); print_r($rez); the result for the above snippet little differ compare to live google search, the above snippet not render first result , that is in google live search first result not displaying the above snippet , AMy i know, what should i have to do now, Regards

    Read the article

  • formatting NSArray

    - by califguy
    So from the code below, I have managed to get the string *tempstring into an array chunk. Now chunk[0] contains 'a' while chunk[1] contains 'aa'. I am trying to format chunk[0] to '0a' which I can using the replaceObjectAtIndex method. Here's my question: How do I detect that chunk[0] is formatted as 'a' and not '0a'. I want to check all the indexes and make sure they have double digits and if not use a 0 to prefix it. NSString *tempstring = @"a-aa-bb"; NSMutableArray *chunk = [tempstring componentsSeparatedByString: @"-"]; NSLog(@"%@",[chunk objectAtIndex:0]);

    Read the article

  • GA written in Java

    - by EnderMB
    I am attempting to write a Genetic Algorithm based on techniques I had picked up from the book "AI Techniques for Game Programmers" that uses a binary encoding and fitness proportionate selection (also known as roulette wheel selection) on the genes of the population that are randomly generated within the program in a two-dimensional array. I recently came across a piece of pseudocode and have tried to implement it, but have come across some problems with the specifics of what I need to be doing. I've checked a number of books and some open-source code and am still struggling to progress. I understand that I have to get the sum of the total fitness of the population, pick a random number between the sum and zero, then if the number is greater than the parents to overwrite it, but I am struggling with the implementation of these ideas. Any help in the implementation of these ideas would be very much appreciated as my Java is rusty.

    Read the article

  • TypeError: 'NoneType' object does not support item assignment

    - by R S John
    I am trying to do some mathematical calculation according to the values at particular index of a NumPy array with the following code X = np.arange(9).reshape(3,3) temp = X.copy().fill(5.446361E-01) ind = np.where(X < 4.0) temp[ind] = 0.5*X[ind]**2 - 1.0 ind = np.where(X >= 4.0 and X < 9.0) temp[ind] = (5.699327E-1*(X[ind]-1)**4)/(X[ind]**4) print temp But I am getting the following error Traceback (most recent call last): File "test.py", line 7, in <module> temp[ind] = 0.5*X[ind]**2 - 1.0 TypeError: 'NoneType' object does not support item assignment Would you please help me in solving this? Thanks

    Read the article

  • problem in counting children category

    - by moustafa
    I have this table: fourn_category (id , sub) I am using this code to count: function CountSub($id){ $root = array($id); $query = mysql_query("SELECT id FROM fourn_category WHERE sub = '$id'"); while( $row = mysql_fetch_array( $query, MYSQL_ASSOC ) ){ array_push($root,$row['id']); CountSub($row['id']); } return implode(",",$root); } It returns the category id as 1,2,3,4,5 to using it to count the sub by IN() But the problem is that it counts this: category 1 category 2 category 3 category 4 category 5 Category 1 has 1 child not 4. Why? How can I get all children's trees?

    Read the article

< Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >