Search Results

Search found 15059 results on 603 pages for 'associative array'.

Page 446/603 | < Previous Page | 442 443 444 445 446 447 448 449 450 451 452 453  | Next Page >

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • .NET Regular expressions on bytes instead of chars

    - by brickner
    Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

    Read the article

  • How to restrict access to my web service?

    - by Hank
    I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

    Read the article

  • implicit parameter definition in class

    - by coubeatczech
    implicit val odkaz = head; def vypis(implicit odkaz:Prvek):String = { odkaz match{ case null => "" case e => e.cislo + " " + e.pocet + "\n" + vypis(e.dalsi) } } ... def main(args:Array[String]){ val q = new MyQueue() // insert some values println(q.vypis) } This method(vypis) is a member of an queue-class so I'll always want to implicity start the recursion from the start of the queue, when calling the method from outside. Is there a way how to write it, that the method from outside calling, there's no paramter, but in inside, there's a parameter - for recursion...? The compiler complains that the parameter is not defined when called from outside

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why does GetClusterShape return null when the cluster specification was retrieved through the GetClu

    - by Markus Olsson
    Suppose I have a virtual earth shape layer called shapeLayer1 (my creative energy is apparently at an alltime low). When i call the GetClusteredShapes method I get an array of VEClusterSpecification objects that represent each and every one of my currently visible clusters; no problem there. But when I call the GetClusterShape() method it returns null... null! Why on earth would it do that? I used firebug to confirm that the private variable of the VEClusterSpecification that's supposed to hold a reference to the shape is indeed null so it's not the method that's causing the problem. Some have suggested that this is actually documented behavior Returns null if a VEClusterSpecification object was returned from the VEShapeLayer.GetClusteredShapes Method But looking at the current MSDN documentation for the VEShape class it says: Returns if a VEClusterSpecification object was returned from the VEShapeLayer.GetClusteredShapes Method Is this a bug or a feature? Is there any known workarounds or (if it is a bug) some plan on when they are going to fix it?

    Read the article

  • Best practices for querying an entire row in a database table? (MySQL / CodeIgniter)

    - by Walker
    Sorry for the novice question! I have a table called cities in which I have fields called id, name, xpos, ypos. I'm trying to use the data from each row to set a div's position and name. What I'm wondering is what's the best practice for dynamically querying an unknown amount of rows (I don't know how many cities there might be, I want to pull the information from all of them) and then passing the variables from the model into the view and then setting attributes with it? Right now I've 'hacked' a solution where I run a different function each time which pulls a value using a query ('SELECT id FROM cities;'), then I store that in a global array variable and pass it into view. I do this for each var so I have arrays called: city_idVar, city_nameVar, city_xposVar, city_yposVar then I know that the city_nameVar[0] matches up with city_xposVar[0] etc. Is there a better way?

    Read the article

  • How can I capture multiple matches from the same Perl regex?

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like: $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • Handle order dependence in for loops

    - by Matt
    Hey all, I'm making a templating system where I instantiate each tag using a foreach loop. The issue is that some of the tags rely on each other so, I'm wondering how to get around that ordering from the looping. Here's an example: Class A { public $width; __construct() { $this->width = $B->width(); // Undefined! Or atleast not set yet.. } } Class B { private $width; __construct() { $this->width = "500px"; } __tostring() { return "Hello World!"; } } Template.php $tags = array("A", "B"); foreach ($tags as $tag) { $TagObj[$tag] = new $tag(); } echo $TagObj['A']->width; // Nadamundo! I know this has applications elsewhere and I'm sure this has been solved before, if someone could enlighten me or point me in the right direction that'd be great! Thanks! Matt Mueler

    Read the article

  • how do i see if a big JSON object contains a value?

    - by Haroldo
    I'm using PHP to json encode a massive multi-dimensional array of events, so i get something like this: var ents = {"7":{"event_id":"7","nn":"The Whisky Drifters","nn_url":"the-whisky-drifters","venue":"The Grain Barge","date_num":"2010-06-11","date_txt":"Friday 11th June","gig_club":"1","sd":"A New Acoustic String Band...","ven_id":"44","art":0},"15":{"event_id":"15","nn":"Bass Kitchen","nn_url":"bass-kitchen","venue":"Timbuk2","date_num":"2010-06-11","date_txt":"Friday 11th June","gig_club":"2","sd":"Hexadecimal \/ DJ Derek \/ Id","ven_id":"21","art":1}, the first dimension is the id, see var ents = {"7":{ So its possible to get the ids without examining the nested objects... What's the fastest, most efficent way to check if my JSON contains an id?

    Read the article

  • C++ Microsoft SAPI: How to set Windows text-to-speech output to a memory buffer?

    - by Vladimir
    Hi all, I have been trying to figure out how to "speak" a text into a memory buffer using Windows SAPI 5.1 but so far no success, even though it seems it should be quite simple. There is an example of streaming the synthesized speech into a .wav file, but no examples of how to stream it to a memory buffer. In the end I need to have the synthesized speech in a char* array in 16 kHz 16-bit little-endian PCM format. Currently I create a temp .wav file, redirect speech output there, then read it, but it seems to be a rather stupid solution. Anyone knows how to do that? Thanks!

    Read the article

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • problem in return value from server to client in ajax useing zend-framework

    - by user1400
    hello i try to use ajax and zend in my application , i could pass variable to server but i can not get data from server , it does not return values, it return all html code page, where is my mistake? $('#myForm').submit(function($e){ $e.preventDefault(); var $paramToServer=$("#myForm").serialize(); $.ajax({ type:'POST', url:'test', data:$paramToServer , success:function(re){ var res = $.evalJSON(re); console.log(res.id); // to see in firebog }, dataType:'json' }); }); public function testAction() { // action body $this->_helper->getHelper('viewRenderer')->setNoRender(); // If you use layout, disable it Zend_Layout::getMvcInstance()->disableLayout(); $name=$this->getRequest()->getParam ( 'name' ); //pass $name to server $return = array( 'id' => '5', 'family' => 'hello ', ); $return = Zend_Json::encode( $return); // Response $this->getResponse()->setBody($return); }

    Read the article

  • Sales figures not displayed in form

    - by Brian Wilson
    Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

    Read the article

  • Inserting multiple types into an SQLite database with Python

    - by mankoff
    I'm trying to create an SQLite 3 database from Python. I have a few types I'd like to insert into each record: A float, and then 3 groups of n floats, currently a tuple but could be an array or list.. I'm not well-enough versed in Python to understand all the differences. My problem is the INSERT statement. DAS = 12345 lats = (42,43,44,45) lons = (10,11,12,13) times = (1,2,3,4,5,6,7,8,9) import sqlite3 connection = sqlite3.connect("test.db") cursor = connection.cursor() cursor.execute( "create table foo(DAS LONG PRIMARY KEY,lats real(4),lons real(4), times real(9) )" ) I'm not sure what comes next. Something along the lines of: cmd = 'INSERT into foo values (?,?,?,?), ..." cursor.execute(cmd) How should I best build the SQL insert command given this data?

    Read the article

  • jQuery Set Child CSS Attribute Problem

    - by Jascha
    I have a child element of a div named "bob" that's class is '.divTitle' <div id="bob"> <div class="divTitle"> <a href="#"> <h1>Title</h1> </a> </div> </div> I am trying to set the background color of "divTitle" to red but for the life of me can't get this to work. Right now I am trying two things... $('#bob').children('.divTitle')[0].css('background-color', '#0f0'); // assuming children is returning an array... and $('#bob').children('.divTitle').css('background-color', '#0f0'); neither with any success... can anyone tell me what I am missing here? Do I have to go deeper than ".children"?

    Read the article

  • What's the simplest way to create a Zend_Form tabular display with each row having a radio button?

    - by RenderIn
    I've seen simple examples of rendering a Zend_Form using decorators, but I'm not sure they are able to handle the issue I'm facing very well. I query the database and get an array of user objects. I want to display these users as a form, with a radio button next to each of them and a submit button at the bottom of the page. Here's roughly what the form will look like: [user id] [email] [full name] ( ) 1 [email protected] Test user 1 (*) 2 [email protected] Test user 2 [SUBMIT] Is this something achievable in a reasonably straightforward way or do I need to use the ViewScript partial?

    Read the article

  • Perl Regex Multiple Items in Single String

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • Regular Expression Help - Brackets within brackets

    - by adbox
    Hello I'm trying to develop a function that can sort through a string that looks like this: Donny went to the {park|store|{beach with friends|beach alone}} so he could get a breath of freash air. What I intend to do is search the text recursively for {} patterns where there is no { or } inside the {}, so only the innermost sandwiched text is selected, where I will then run a php to array the contents and select one at random, repeating process until the whole string has been parsed, showing a complete sentence. I just cannot wrap my head around regular expressions though. Appreciate any help!

    Read the article

  • Session in Iframe working in Firefox but not in Internet Explorer

    - by Younes
    Im trying to get a form working in Internet Explorer. I see that when i submit this form in Firefox I can start a session and send my webbrowser to the right page based on that Session. In Internet Explorer however when i'm debugging the $_SESSION i retrieve an empty array back, this means that in Internet Explorer the session isn't started on my second page. This is the code i'm using to print the session on my second page: session_start(); //unset($_SESSION['bp_email']); include("includes/_dbconnect.php"); print_r($_SESSION); die();

    Read the article

  • Using a table-alias in Kohana queries?

    - by Aristotle
    I'm trying to run a simple query with $this->db in Kohana, but am running into some syntax issues when I try to use an alias for a table within my query: $result = $this->db ->select("ci.chapter_id, ci.book_id, ci.chapter_heading, ci.chapter_number") ->from("chapter_info ci") ->where(array("ci.chapter_number" => $chapter, "ci.book_id" => $book)) ->get(); It seems to me that this should work just fine. I'm stating that "chapter_info" ought to be known as "ci," yet this isn't taking for some reason. The error is pretty straight-forward: There was an SQL error: Table 'gb_data.chapter_info ci' doesn't exist - SELECT `ci`.`chapter_id`, `ci`.`book_id`, `ci`.`chapter_heading`, `ci`.`chapter_number` FROM (`chapter_info ci`) WHERE `ci`.`chapter_number` = 1 AND `ci`.`book_id` = 1 If I use the full table name, rather than an alias, I get the expected results without error. This requires me to write much more verbose queries, which isn't ideal. Is there some way to use shorter names for tables within Kohana's query-builder?

    Read the article

  • how to use a pear package!?

    - by Naughty.Coder
    I want to use HTTP_DOWNLOAD to manage my downloads ,, I have never used PEAR before !! HTTP_DOWNLOAD depends on many other packages , I downloaded them and the ones they , in turn , depend on and this is the structure I made : Download.PHP <---HTTP_DOWNLOAD MAIN FILE Header.php <--- HTTP_HEADER MAIN FILE PEAR.php PEAR5.php Type.php <--- MIME_Type >Type <---- FOLDER - Extension.php MIME_Type File - Parameter.php MIME_Type File assuming that Http_DOWNLOAD depends on : * PHP 4.2.0 * PEAR 1.4.0b1 * PEAR * HTTP_Header * pcre extension * Archive_Tar (Optional) * Archive_Zip (Optional) * MIME_Type (Optional) * mime_magic extension (Optional) * pgsql extension (Optional) and I edited the paths inside each file to reflect this structure , and I tried to run the following code : <?php require_once 'Download.php'; $params = array('file'=>'file.zip'); $down = new HTTP_Download($params); $down->send(true); ?> nothing happens !! I also got a hard time trying to figure how to use the class and I think this code should work .. but not sure ! Help Please !

    Read the article

  • Problem searching a NSMutableArray

    Basically, I have a UISearchBar searching an NSMutableArray of stories that make up an RSS feed, and when you select a story, it loads in my app's UIWebView. It's difficult to explain, but I have a list of entries 1, 2, 3, and 4 and you search for '4'. 4 will be the first entry in the now-filtered list of data, right? You'd think that by selecting 4, it would load in the UIWebView. Well, the app seems to not recognize that you're selecting the first entry in a filtered list of data, and instead thinks that you're selecting the first entry in the unfiltered array of data, so it loads entry 1. Everything looks right in my code, but obviously it isn't. I know it's a confusing problem, but I hope I made it somewhat clear. Anyway, here's the relevant source so that you may see exactly what I mean: Search.h: http://www.scribd.com/doc/13107802/Searchh Search.m: http://www.scribd.com/doc/13107812/Searchm

    Read the article

< Previous Page | 442 443 444 445 446 447 448 449 450 451 452 453  | Next Page >