Search Results

Search found 15218 results on 609 pages for 'scoped array'.

Page 451/609 | < Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >

  • Creating a proper CMS thoughts

    - by dallasclark
    I'm just about to expand the functionality of our own CMS but was thinking of restructuring the database to make it simpler to add/edit data types and values. Currently, the CMS is quite flat - the CMS requires a field in the database for every type of stored value. The first option that comes to mind is simply a table which keeps the data types (ie: Address 1, Suburb, Email Address etc) and another table which holds values for each of these data types. Just like how Wordpress keeps values in the 'options' table, serialize would be used to store an array of values. The second option is how Drupal works, the CMS creates tables for every data type. Unlike Wordpress, this can be a bit of an overkill but really useful for SQL queries when ordering and grouping by a particular value. What's everyone's thoughts?

    Read the article

  • Estimate serialization size of objects?

    - by Stefan K.
    In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

    Read the article

  • [wxWidgets] How to store wxImage into database, using C++?

    - by Thomas Matthews
    I have some wxImages and I would like to store them into a BLOB (Binary Large OBject) field in a MySQL database. There are no methods in wxImage nor wxBitmap for obtaining the binary data as an array of unsigned char so I can load into the database. My current workaround is to write the image to a temporary file, then load the BLOB field directly from the file. Is there a more efficient method to load and store a wxImage object into a MySQL BLOB field? I am using MySql C++ connector 1.05, MS Visual Studio 2008, wxWidgets and C++.

    Read the article

  • Sales figures not displayed in form

    - by Brian Wilson
    Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

    Read the article

  • How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

    - by jphenow
    I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • .NET Regular expressions on bytes instead of chars

    - by brickner
    Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

    Read the article

  • How to get nearby POIs

    - by balexandre
    I have a database with Points of Interest that all have an address. I want to know what is the method/name/call to get all nearby POIs from a given position. I understand that I need to convert all my addresses to LAT / LON coordinates at least, but my question is: for a given LAT / LONG how do I get from the database/array what POIs are nearby by distance, for example: You are here 0,0 nearest POIs in a 2km radius are: POI A (at 1.1 Km) POI C (at 1.3 Km) POI F (at 1.9 Km) I have no idea what should I look into to get what I want :-( Any help is greatly appreciated. Thank you

    Read the article

  • rails update whole index of a model with one click

    - by mattherick
    hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • How to restrict access to my web service?

    - by Hank
    I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

    Read the article

  • Zend Framework PartialLoop - questions

    - by Ian Warner
    Hi Ok dealing with Partial Loops I want to do several things Perhaps pass in extra variables - seen it done like this echo $this-partialLoop('Loop.phtml', array('data' = $data, 'var1' = foo)); But this does not seem to work - I can not extra the data using $this-var $this-data-var or $data-var not sure how to access the data in the loop Sutotals for columns - need a way of resetting variables or passing in a default value - linked to the above I suppose ie $subtotal += rowTotal; In the view that calls the partial I would like to get access to the subtotal values generated so I can display these in another table below. Any help appreciated the docs on partialLoop seems incomplete. Ian

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • Helper functions & prototype methods to replace heavy frameworks?

    - by Rob
    All frameworks aside, what are some of the common helper functions/prototype methods you use on a daily basis? Please note I am not arguing against frameworks. I've simply found that the majority of what I do on a daily basis can, most often, be done with a few dozen Array, String and Element.prototype methods. With the addition of a few helper functions like $ (getElementsById) and $$$ (getElementsByClass), I am able to satisfy some of the core benefits, however basic, of a much heavier framework. If you were to collect a small library of basic methods and functions to replace the core functionality of some of the popular frameworks, what would they be?

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Grouping search results with thinking_sphinx plugin for rails

    - by Shagymoe
    I can use the following to group results, but it only returns one result per group. @results = Model.search params[:search_query], :group_by => 'created_at', :group_function => :day, :page => params[:page], :per_page => 50 So, if I display the results by day, I only get one result per day. <% @results.each_with_groupby do |result, group| %> <div class="group"><%= group %></div> <ul class="result"> <li><%= result.name %></li> </ul> <% end %> Do I have to parse the @results array and group them by date manually or am I missing something? Here is the line from the sphinx docs: http://sphinxsearch.com/docs/current.html#clustering "The final search result set then contains one best match per group."

    Read the article

  • Setting post tags in wordpress via XMLRPC API when submitting a post?

    - by aviv
    Hi, I am trying to use WordPress API via XMLRPC to submit new posts. But i can't set the post tags (nor the categories). echo "Adding $term to blog via XMLRPC ..."; $client = new IXR_Client("http://$blog.wordpress.com/xmlrpc.php"); $content = array('title'=>$term, 'description'=>"All about $term", 'category'=>'barvaz,moshe', 'tags'=>'tag1,tag2'); $client->query('metaWeblog.newPost', 0, $username, $password, $content, true); $rv = $client->getResponse(); print_r($rv); Any idea?

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Refreshing a UITableView

    - by MihaiD
    I have a UITableView subclass and a UITableViewCell sublass that I'm using for cells. I'm bulding all my cells in advance and store them in an array from where I use them in cellForRowAtIndexPath. Aside from this I have a thread that loads some images in each cell, in the background. The problem is that the cells don't get refreshed as fast as the images are loaded. For example, if I don't scroll my table view, the first cells only get refreshed when all cells have been modified and the thread has exited. Any ideas on how I can effectively refresh my tableview/cell?

    Read the article

  • Best practices for querying an entire row in a database table? (MySQL / CodeIgniter)

    - by Walker
    Sorry for the novice question! I have a table called cities in which I have fields called id, name, xpos, ypos. I'm trying to use the data from each row to set a div's position and name. What I'm wondering is what's the best practice for dynamically querying an unknown amount of rows (I don't know how many cities there might be, I want to pull the information from all of them) and then passing the variables from the model into the view and then setting attributes with it? Right now I've 'hacked' a solution where I run a different function each time which pulls a value using a query ('SELECT id FROM cities;'), then I store that in a global array variable and pass it into view. I do this for each var so I have arrays called: city_idVar, city_nameVar, city_xposVar, city_yposVar then I know that the city_nameVar[0] matches up with city_xposVar[0] etc. Is there a better way?

    Read the article

  • Overwriting arguments object for a Javascript function

    - by Ian Storm Taylor
    If I have the following: // Clean input. $.each(arguments, function(index, value) { arguments[index] = value.replace(/[\W\s]+/g, '').toLowerCase(); }); Would that be a bad thing to do? I have no further use for the uncleaned arguments in the function, and it would be nice not to create a useless copy of arguments just to use them, but are there any negative effects to doing this? Ideally I would have done this, but I'm guessing this runs into problems since arguments isn't really an Array: arguments = $.map(arguments, function(value) { return value.replace(/[\W\s]+/g, '').toLowerCase(); }); Thanks for any input. EDIT: I've just realized that both of these are now inside their own functions, so the arguments object has changed. Any way to do this without creating an unnecessary variable?

    Read the article

  • Implementing a configurable factory

    - by Decko
    I'm having difficulties finding out how to implement a 'configurable' behavior in a factory class in PHP. I've got at class, which takes another class as an argument in its constructor. The argument class could take a number of arguments in its constructor. An instance of my main class could look something like this $instance = new MyClass(new OtherClass(20, true)); $instance2 = new MyClass(new DifferentClass('test')); This is rather clumsy and has a number of problems and therefore I would like to move this into a factory class. The problem is that this factory somehow needs to know how to instantiate the argument class, as this class can have any number of arguments in the constructor. Preferably I would like to be able to do something like this $instance = Factory::build('OtherClass'); $instance2 = Factory::build('DifferentClass'); And let the factory retrieve the arguments from a configuration array or similar. Is there a proper solution to this problem?

    Read the article

  • Which are your favorite programming language gadgets?

    - by FerranB
    There are some gadgets/features for programming languages that I like a lot because they save a lot of coding or simply because they are magical or nice. Some of my favorites are: C++ increment/decrement operator: my_array[++c]; C++ assign and sum or substract (...): a += b C# yield return: yield return 1; C# foreach: foreach (MyClass x in MyCollection) PLSQL for loop: for c in (select col1, col2 from mytable) PLSQL pipe row: for i in 1..x loop pipe row(i); end loop; Python Array access operator: a[:1] PLSQL ref cursors. Which are yours?

    Read the article

  • Drag and Drop to explorer causing invalid FORMATETC (DV_E_FORMATETC) error

    - by JustABill
    I'm trying to use this excellent example to implement dropping virtual files into Windows Explorer. However, I'm stymied by this error. Towards the bottom, inside void System.Runtime.InteropServices.ComTypes.IDataObject.GetData(ref System.Runtime.InteropServices.ComTypes.FORMATETC formatetc, out System.Runtime.InteropServices.ComTypes.STGMEDIUM medium) on the first call to ((System.Runtime.InteropServices.ComTypes.IDataObject)this).GetDataHere(ref formatetc, ref medium); I'm getting back a DV_E_FORMATETC error. As far as I can tell, all the elements of the FORMATETC struct that are being passed in are valid: cfFormat is "Shell IDList Array" (-16141), ptd is 0, dwAspect is DVASPECT_CONTENT, lindex is -1, and tymed is TYMED_HGLOBAL. I'm kind of confused how there'd be a problem anyway, since this was generated by explorer. I know very little about COM interaction, so any help would be greatly appreciated.

    Read the article

< Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >