Search Results

Search found 34838 results on 1394 pages for 'java se'.

Page 483/1394 | < Previous Page | 479 480 481 482 483 484 485 486 487 488 489 490  | Next Page >

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • JSF tags not being rendered as HTML

    - by Toto
    I'm following the Java EE firstcup tutorial using Netbeans and Glassfish. When I execute the JSF web tier I've been instructed to code, the browser gets the same JSF markup coded in the .xhtml file, and the tags are not rendered as HTML tags. I know this by using the view source code in my browser. For example, for this code: <html xmlns="http://www.w3.org/1999/xhtml" xmlns:f="http://java.sun.com/jsf/core" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Page title here</title> </h:head> <h:body> <h2> <h:outputText value="#{bundle.WelcomeMessage}" /> </h2> </h:body> </html> The browser should get something like: <html ...> <head> <title>Page title here</title> </head> <body> <h2> the welcome message goes here </h2> </body> </html> Right? Well, my browser is getting jsf code (the first piece of code above) and not the html code (the second piece of code above). It seems to be a configuration problem in netbeans or glassfish but don't know what. Any ideas? This is my web.xml file: <?xml version="1.0" encoding="UTF-8"?> <web-app version="3.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd"> <context-param> <param-name>javax.faces.PROJECT_STAGE</param-name> <param-value>Development</param-value> </context-param> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>Faces Servlet</servlet-name> <url-pattern>/firstcup/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>greetings.xhtml</welcome-file> </welcome-file-list> </web-app> This is my faces-config.xml file: <?xml version='1.0' encoding='UTF-8'?> <!-- =========== FULL CONFIGURATION FILE ================================== --> <faces-config version="2.0" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-facesconfig_2_0.xsd"> <application> <resource-bundle> <base-name>firstcup.web.WebMessages</base-name> <var>bundle</var> </resource-bundle> <locale-config> <default-locale>en</default-locale> <supported-locale>es</supported-locale> </locale-config> </application> <navigation-rule> <from-view-id>/greetings.xhtml</from-view-id> <navigation-case> <from-outcome>success</from-outcome> <to-view-id>/response.xhtml</to-view-id> </navigation-case> </navigation-rule> </faces-config> Moreover: The url I'm entering in the browser is http://localhost:8081/firstcup/ but I've also tried: http://localhost:8081/firstcup/greetings.xhtml I've checked Glassfish logs and there's no information about not being able to load FacesServlet

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • Non-blocking I/O using Servlet 3.1: Scalable applications using Java EE 7 (TOTD #188)

    - by arungupta
    Servlet 3.0 allowed asynchronous request processing but only traditional I/O was permitted. This can restrict scalability of your applications. In a typical application, ServletInputStream is read in a while loop. public class TestServlet extends HttpServlet {    protected void doGet(HttpServletRequest request, HttpServletResponse response)         throws IOException, ServletException {     ServletInputStream input = request.getInputStream();       byte[] b = new byte[1024];       int len = -1;       while ((len = input.read(b)) != -1) {          . . .        }   }} If the incoming data is blocking or streamed slower than the server can read then the server thread is waiting for that data. The same can happen if the data is written to ServletOutputStream. This is resolved in Servet 3.1 (JSR 340, to be released as part Java EE 7) by adding event listeners - ReadListener and WriteListener interfaces. These are then registered using ServletInputStream.setReadListener and ServletOutputStream.setWriteListener. The listeners have callback methods that are invoked when the content is available to be read or can be written without blocking. The updated doGet in our case will look like: AsyncContext context = request.startAsync();ServletInputStream input = request.getInputStream();input.setReadListener(new MyReadListener(input, context)); Invoking setXXXListener methods indicate that non-blocking I/O is used instead of the traditional I/O. At most one ReadListener can be registered on ServletIntputStream and similarly at most one WriteListener can be registered on ServletOutputStream. ServletInputStream.isReady and ServletInputStream.isFinished are new methods to check the status of non-blocking I/O read. ServletOutputStream.canWrite is a new method to check if data can be written without blocking.  MyReadListener implementation looks like: @Overridepublic void onDataAvailable() { try { StringBuilder sb = new StringBuilder(); int len = -1; byte b[] = new byte[1024]; while (input.isReady() && (len = input.read(b)) != -1) { String data = new String(b, 0, len); System.out.println("--> " + data); } } catch (IOException ex) { Logger.getLogger(MyReadListener.class.getName()).log(Level.SEVERE, null, ex); }}@Overridepublic void onAllDataRead() { System.out.println("onAllDataRead"); context.complete();}@Overridepublic void onError(Throwable t) { t.printStackTrace(); context.complete();} This implementation has three callbacks: onDataAvailable callback method is called whenever data can be read without blocking onAllDataRead callback method is invoked data for the current request is completely read. onError callback is invoked if there is an error processing the request. Notice, context.complete() is called in onAllDataRead and onError to signal the completion of data read. For now, the first chunk of available data need to be read in the doGet or service method of the Servlet. Rest of the data can be read in a non-blocking way using ReadListener after that. This is going to get cleaned up where all data read can happen in ReadListener only. The sample explained above can be downloaded from here and works with GlassFish 4.0 build 64 and onwards. The slides and a complete re-run of What's new in Servlet 3.1: An Overview session at JavaOne is available here. Here are some more references for you: Java EE 7 Specification Status Servlet Specification Project JSR Expert Group Discussion Archive Servlet 3.1 Javadocs

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • The Developer's Conference Florianópolis, Brazil

    - by Tori Wieldt
    by guest blogger Yara Senger With over 2900 developers in person and another 2000 online, The Developer's Conference (TDC) in Florianópolis, Brazil, reminds us that Java is BIG in Brazil. The conference included 20 different tracks, and Java was the most popular track. Java was also a big part of the talks in the IoT, Cloud and BigData tracks. Here's my overview (in Brazilian Portguese): Several JUGs were involved in TDC Florianópolis, serving as track leads, speakers and all-around heros, including SouJava SouJava Campinas GUJava Santa Catarina JUG Vale JUG Maringá Java Bahia GOJava (Goinia) JUG Rio do Sul RS Jug (Rio Grande do Sul) and I thank them for their support and commitment. It is a vibrant and fun community! We saw that the IoT space is maturing rapidly. There are already some related to embedded in the region.  Java Evangelist Bruno Borges and Marco Antonio Maciel gave a view popular talk "Java: Tweet for Beer!" They demonstrated how to make a beer tap controlled by Java and connected to the Internet, using a visual application JavaFX with Java SE 8, running on a Rasperry Pi. Of course, they had to test the application quite throughly.   We Brazilians are training the next generation of Java developers. TDC4Kids was as big success. We made a tour with the kids in all booths and almost everybody talked about Java. Java in government managment (Betha), Java on the 2048  (Oracle), Java on the popcorn machine and Java training (Globalcode & V.Office) and of course: Java & Minecraft! OTN's Pablo Ciccarello was there to support the community.  He did several video interviews with JUG leaders and speakers (mine included). You can watch more videos on his TDC Florianópolis playlist.  Thank you, Oracle and OTN for all your support. We interacted with thousands of Java developers at The Developer's Conference Florianópolis. If you want to join us, we are planning two more conferences this year: The Developer's Conference São Paulo, July  The Developer's Conference Porto Alegre, October 

    Read the article

  • android View not attached to window manager...

    - by Daniel Benedykt
    Hi I am having some of the following exceptions: java.lang.IllegalArgumentException: View not attached to window manager at android.view.WindowManagerImpl.findViewLocked(WindowManagerImpl.java:355) at android.view.WindowManagerImpl.updateViewLayout(WindowManagerImpl.java:191) at android.view.Window$LocalWindowManager.updateViewLayout(Window.java:428) at android.app.Dialog.onWindowAttributesChanged(Dialog.java:596) at android.view.Window.setDefaultWindowFormat(Window.java:1013) at com.android.internal.policy.impl.PhoneWindow.access$700(PhoneWindow.java:86) at com.android.internal.policy.impl.PhoneWindow$DecorView.drawableChanged(PhoneWindow.java:1951) at com.android.internal.policy.impl.PhoneWindow$DecorView.fitSystemWindows(PhoneWindow.java:1889) at android.view.ViewRoot.performTraversals(ViewRoot.java:727) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4338) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have google it and see that it has something to do with popups and turning the screen, but there is no reference to my code. The questions are: 1) is there a way to find out exactly when this issue is happening? 2) other than turning the screen, is there another event or action that triggers this error? 3) how do I prevent this to happen? Thanks

    Read the article

  • OpenLDAP and SSL

    - by Stormshadow
    I am having trouble trying to connect to a secure OpenLDAP server which I have set up. On running my LDAP client code java -Djavax.net.debug=ssl LDAPConnector I get the following exception trace (java version 1.6.0_17) trigger seeding of SecureRandom done seeding SecureRandom %% No cached client session *** ClientHello, TLSv1 RandomCookie: GMT: 1256110124 bytes = { 224, 19, 193, 148, 45, 205, 108, 37, 101, 247, 112, 24, 157, 39, 111, 177, 43, 53, 206, 224, 68, 165, 55, 185, 54, 203, 43, 91 } Session ID: {} Cipher Suites: [SSL_RSA_WITH_RC4_128_MD5, SSL_RSA_WITH_RC4_128_SHA, TLS_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_DSS_WITH_AES_128_CBC_SHA, SSL_RSA_W ITH_3DES_EDE_CBC_SHA, SSL_DHE_RSA_WITH_3DES_EDE_CBC_SHA, SSL_DHE_DSS_WITH_3DES_EDE_CBC_SHA, SSL_RSA_WITH_DES_CBC_SHA, SSL_DHE_RSA_WITH_DES_CBC_SHA, SSL_DHE_DSS_WITH_DES_CBC_SH A, SSL_RSA_EXPORT_WITH_RC4_40_MD5, SSL_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA] Compression Methods: { 0 } *** Thread-0, WRITE: TLSv1 Handshake, length = 73 Thread-0, WRITE: SSLv2 client hello message, length = 98 Thread-0, received EOFException: error Thread-0, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake Thread-0, SEND TLSv1 ALERT: fatal, description = handshake_failure Thread-0, WRITE: TLSv1 Alert, length = 2 Thread-0, called closeSocket() main, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake javax.naming.CommunicationException: simple bind failed: ldap.natraj.com:636 [Root exception is javax.net.ssl.SSLHandshakeException: Remote host closed connection during hands hake] at com.sun.jndi.ldap.LdapClient.authenticate(Unknown Source) at com.sun.jndi.ldap.LdapCtx.connect(Unknown Source) at com.sun.jndi.ldap.LdapCtx.<init>(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURL(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURLs(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getLdapCtxInstance(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getInitialContext(Unknown Source) at javax.naming.spi.NamingManager.getInitialContext(Unknown Source) at javax.naming.InitialContext.getDefaultInitCtx(Unknown Source) at javax.naming.InitialContext.init(Unknown Source) at javax.naming.InitialContext.<init>(Unknown Source) at javax.naming.directory.InitialDirContext.<init>(Unknown Source) at LDAPConnector.CallSecureLDAPServer(LDAPConnector.java:43) at LDAPConnector.main(LDAPConnector.java:237) Caused by: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.performInitialHandshake(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readDataRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.AppInputStream.read(Unknown Source) at java.io.BufferedInputStream.fill(Unknown Source) at java.io.BufferedInputStream.read1(Unknown Source) at java.io.BufferedInputStream.read(Unknown Source) at com.sun.jndi.ldap.Connection.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Caused by: java.io.EOFException: SSL peer shut down incorrectly at com.sun.net.ssl.internal.ssl.InputRecord.read(Unknown Source) ... 9 more I am able to connect to the same secure LDAP server however if I use another version of java (1.6.0_14) I have created and installed the server certificates in the cacerts of both the JRE's as mentioned in this guide -- OpenLDAP with SSL When I run ldapsearch -x on the server I get # extended LDIF # # LDAPv3 # base <dc=localdomain> (default) with scope subtree # filter: (objectclass=*) # requesting: ALL # # localdomain dn: dc=localdomain objectClass: top objectClass: dcObject objectClass: organization o: localdomain dc: localdomain # admin, localdomain dn: cn=admin,dc=localdomain objectClass: simpleSecurityObject objectClass: organizationalRole cn: admin description: LDAP administrator # search result search: 2 result: 0 Success # numResponses: 3 # numEntries: 2 On running openssl s_client -connect ldap.natraj.com:636 -showcerts , I obtain the self signed certificate. My slapd.conf file is as follows ####################################################################### # Global Directives: # Features to permit #allow bind_v2 # Schema and objectClass definitions include /etc/ldap/schema/core.schema include /etc/ldap/schema/cosine.schema include /etc/ldap/schema/nis.schema include /etc/ldap/schema/inetorgperson.schema # Where the pid file is put. The init.d script # will not stop the server if you change this. pidfile /var/run/slapd/slapd.pid # List of arguments that were passed to the server argsfile /var/run/slapd/slapd.args # Read slapd.conf(5) for possible values loglevel none # Where the dynamically loaded modules are stored modulepath /usr/lib/ldap moduleload back_hdb # The maximum number of entries that is returned for a search operation sizelimit 500 # The tool-threads parameter sets the actual amount of cpu's that is used # for indexing. tool-threads 1 ####################################################################### # Specific Backend Directives for hdb: # Backend specific directives apply to this backend until another # 'backend' directive occurs backend hdb ####################################################################### # Specific Backend Directives for 'other': # Backend specific directives apply to this backend until another # 'backend' directive occurs #backend <other> ####################################################################### # Specific Directives for database #1, of type hdb: # Database specific directives apply to this databasse until another # 'database' directive occurs database hdb # The base of your directory in database #1 suffix "dc=localdomain" # rootdn directive for specifying a superuser on the database. This is needed # for syncrepl. rootdn "cn=admin,dc=localdomain" # Where the database file are physically stored for database #1 directory "/var/lib/ldap" # The dbconfig settings are used to generate a DB_CONFIG file the first # time slapd starts. They do NOT override existing an existing DB_CONFIG # file. You should therefore change these settings in DB_CONFIG directly # or remove DB_CONFIG and restart slapd for changes to take effect. # For the Debian package we use 2MB as default but be sure to update this # value if you have plenty of RAM dbconfig set_cachesize 0 2097152 0 # Sven Hartge reported that he had to set this value incredibly high # to get slapd running at all. See http://bugs.debian.org/303057 for more # information. # Number of objects that can be locked at the same time. dbconfig set_lk_max_objects 1500 # Number of locks (both requested and granted) dbconfig set_lk_max_locks 1500 # Number of lockers dbconfig set_lk_max_lockers 1500 # Indexing options for database #1 index objectClass eq # Save the time that the entry gets modified, for database #1 lastmod on # Checkpoint the BerkeleyDB database periodically in case of system # failure and to speed slapd shutdown. checkpoint 512 30 # Where to store the replica logs for database #1 # replogfile /var/lib/ldap/replog # The userPassword by default can be changed # by the entry owning it if they are authenticated. # Others should not be able to see it, except the # admin entry below # These access lines apply to database #1 only access to attrs=userPassword,shadowLastChange by dn="cn=admin,dc=localdomain" write by anonymous auth by self write by * none # Ensure read access to the base for things like # supportedSASLMechanisms. Without this you may # have problems with SASL not knowing what # mechanisms are available and the like. # Note that this is covered by the 'access to *' # ACL below too but if you change that as people # are wont to do you'll still need this if you # want SASL (and possible other things) to work # happily. access to dn.base="" by * read # The admin dn has full write access, everyone else # can read everything. access to * by dn="cn=admin,dc=localdomain" write by * read # For Netscape Roaming support, each user gets a roaming # profile for which they have write access to #access to dn=".*,ou=Roaming,o=morsnet" # by dn="cn=admin,dc=localdomain" write # by dnattr=owner write ####################################################################### # Specific Directives for database #2, of type 'other' (can be hdb too): # Database specific directives apply to this databasse until another # 'database' directive occurs #database <other> # The base of your directory for database #2 #suffix "dc=debian,dc=org" ####################################################################### # SSL: # Uncomment the following lines to enable SSL and use the default # snakeoil certificates. #TLSCertificateFile /etc/ssl/certs/ssl-cert-snakeoil.pem #TLSCertificateKeyFile /etc/ssl/private/ssl-cert-snakeoil.key TLSCipherSuite TLS_RSA_AES_256_CBC_SHA TLSCACertificateFile /etc/ldap/ssl/server.pem TLSCertificateFile /etc/ldap/ssl/server.pem TLSCertificateKeyFile /etc/ldap/ssl/server.pem My ldap.conf file is # # LDAP Defaults # # See ldap.conf(5) for details # This file should be world readable but not world writable. HOST ldap.natraj.com PORT 636 BASE dc=localdomain URI ldaps://ldap.natraj.com TLS_CACERT /etc/ldap/ssl/server.pem TLS_REQCERT allow #SIZELIMIT 12 #TIMELIMIT 15 #DEREF never

    Read the article

  • Android Jelly bean database is locked (code 5)

    - by mtraxdroid
    Im getting a database is locked (code 5) in my ListActivity the code works in the other versions of the Emulator but fails in the 4.1 version of the emulator E/SQLiteLog( 2132): (5) database is locked E/SQLiteDatabase( 2132): Failed to open database '/data/data/id.online.mydroid/databases/geo.db'. E/SQLiteDatabase( 2132): android.database.sqlite.SQLiteDatabaseLockedException: database is locked (code 5): , while compiling: PRAGMA al_mode E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.nativePrepareStatement(Native Method) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.acquirePreparedStatement(SQLiteConnection.java:882) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.executeForString(SQLiteConnection.java:627) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setJournalMode(SQLiteConnection.java:313) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setWalModeFromConfiguration(SQLiteConnection.java:287) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:215) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:193) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.openConnectionLocked(SQLiteConnectionPool.java:463) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:185) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:177) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openInner(SQLiteDatabase.java:804) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.open(SQLiteDatabase.java:789) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openDatabase(SQLiteDatabase.java:694) E/SQLiteDatabase( 2132): at android.app.ContextImpl.openOrCreateDatabase(ContextImpl.java:804) E/SQLiteDatabase( 2132): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getDatabaseLocked(SQLiteOpenHelper.java:224) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getReadableDatabase(SQLiteOpenHelper.java:188) E/SQLiteDatabase( 2132): at id.online.mydroid.myDB.openForRead(myDB.java:158) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.refreshCount(mydroid.java:207) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.onResume(mydroid.java:525) Blockquote

    Read the article

  • Android 2.2 and "Bad address family" on Socket Connect

    - by Josh
    I have a fairly simple game that works perfectly on every version now up through 2.1, but with the new 2.2 (Froyo) release I am unable to create a socket. I am using the mina package for nio, and get this exception: W/System.err( 263): java.net.SocketException: Bad address family W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connectStreamWithTimeoutSocketImpl(Native Method) W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connect(OSNetworkSystem.java:115) W/System.err( 263): at org.apache.harmony.nio.internal.SocketChannelImpl.connect(SocketChannelImpl.java:272) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl$SinkChannelImpl.finishConnect(PipeImpl.java:164) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl.(PipeImpl.java:48) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openPipe(SelectorProviderImpl.java:51) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.(SelectorImpl.java:141) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openSelector(SelectorProviderImpl.java:58) W/System.err( 263): at java.nio.channels.Selector.open(Selector.java:48) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.startupWorker(SocketConnector.java:248) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:210) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) Later in the log, usually immediately following I get this: W/System.err( 263): java.lang.NullPointerException W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.wakeup(SelectorImpl.java:418) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:222) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) I have done all the googling and looking around I can think of and found nothing. The closest I have come seems to be an old JDK bug with ipv6 support on XP and Vista machines (I'm running Vista). Recommendations included disabling ipv6 (that did not work) and disabling ipv4 and leaving ipv6 (will not work for me as my router and ISP don't support it and so could not test anyway). Any thoughts, suggestions, things I have not tried? Thanks, Josh

    Read the article

  • Java SortedMap to Scala TreeMap

    - by Dave
    I'm having trouble converting a java SortedMap into a scala TreeMap. The SortedMap comes from deserialization and needs to be converted into a scala structure before being used. Some background, for the curious, is that the serialized structure is written through XStream and on desializing I register a converter that says anything that can be assigned to SortedMap[Comparable[_],_] should be given to me. So my convert method gets called and is given an Object that I can safely cast because I know it's of type SortedMap[Comparable[_],_]. That's where it gets interesting. Here's some sample code that might help explain it. // a conversion from comparable to ordering scala> implicit def comparable2ordering[A <: Comparable[A]](x: A): Ordering[A] = new Ordering[A] { | def compare(x: A, y: A) = x.compareTo(y) | } comparable2ordering: [A <: java.lang.Comparable[A]](x: A)Ordering[A] // jm is how I see the map in the converter. Just as an object. I know the key // is of type Comparable[_] scala> val jm : Object = new java.util.TreeMap[Comparable[_], String]() jm: java.lang.Object = {} // It's safe to cast as the converter only gets called for SortedMap[Comparable[_],_] scala> val b = jm.asInstanceOf[java.util.SortedMap[Comparable[_],_]] b: java.util.SortedMap[java.lang.Comparable[_], _] = {} // Now I want to convert this to a tree map scala> collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) }) <console>:15: error: diverging implicit expansion for type Ordering[A] starting with method Tuple9 in object Ordering collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) })

    Read the article

  • Place the business logic in Java Beans?

    - by Lirik
    I was reading this page and I found the following statement: MVC in Java Server Pages Now that we have a convenient architucture to separate the view, how can we leverage that? Java Server Pages (JSP) becomes more interesting because the HTML content can be separated from the Java business objects. JSP can also make use of Java Beans. The business logic could be placed inside Java Beans. If the design is architected correctly, a Web Designer could work with HTML on the JSP site without interfering with the Java developer. Interestingly in my textbook I pulled the following quote: In the MVC architecture... the original request is always handled by a servlet. The servlet invokes the business logic and data access code and creates beans to represent the results (that’s the model). Then, the servlet decides which Java Server Page is appropriate to present those particular results and forwards the request there (the JSP is the view). The servlet decides what business logic code applies and which JSP should present the results (the servlet is the controller). The two statements seem slightly contradicting. What is the best way to use beans: should we place business logic in them or should we only place results in them? Are there ways in which beans are inadequate for representing a model?

    Read the article

  • shift reduce&& reduce reduce errors in build parser for python garmmer

    - by user366580
    i wanna build buttom up parser by java cup i write code in java cup , it is for python language so i used grammer was written in this site : but not all grammer , i choice partial set ,just while , identifer also i smiplified them when i did compile for the java cup that i write by write this command in command prompt window : java java_cup.Main -parser CalcParser -symbols CalcSymbol < javacupfile.cup i get conflict errors ,they are of type reduce-shift conflict and reduce-reduce conflict you can see to print screen of the errors in these links image 1 click here to see imge1 the grammer was in EBNF form in as refernce site and i convert it to BNF form maybe i make mistake in converting so i get such errors the origanl grammmer was // grammer in EBNF form identifier ::= (letter|"_") (letter | digit | "_")* letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 compound_stmt ::= if_stmt | while_stmt for_stmt ::= "for" target_list "in" expression_list ":" suite ["else" ":" suite] while_stmt ::= "while" expression ":" suite ["else" ":" suite] suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt (";" simple_stmt)* [";"] simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression ( "," expression )* [","] expression ::= conditional_expression conditional_expression ::= or_test ["if" or_test "else" expression] or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr ( comp_operator or_expr )* comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr the grammer after converting to BNF form identifier ::=letterletter| letterdigit| letter"_"| "_"letter | "_"digit | "_""_" letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 while_stmt ::= "while" expression ":" suite "else" ":" suite |"while" expression ":" suite suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt ";" simple_stmt stmt_list|";" simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression "," expression expression_list| "," expression ::= conditional_expression conditional_expression ::= or_test "if" or_test "else" expression |or_test or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr comp_operator or_expr comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr and the java cup file that i compile and get those errors is import java.io.*; terminal COMA; terminal ELSE; terminal WHILE; terminal NEWLINE; terminal SEMCOLON; terminal CAMMA; terminal IF; terminal OR; terminal AND; terminal NOT; terminal LESS; terminal GREATER; terminal EQUAL; terminal GREATERorE; terminal LESSorE; terminal NEQUAL; terminal OROP; terminal XOROP; terminal ANDOP; terminal Integer DIGIT; terminal java.lang.String LOWERCASE; terminal java.lang.String UPPERCASE; non terminal java.lang.String IDENTIFIER; non terminal java.lang.String LETTER; non terminal COMPOUND_STMT; non terminal WHILE_STMT; non terminal EXPRESSION; non terminal SUITE ; non terminal STMT_LIST; non terminal SIMPLE_STMT; non terminal EXPRESSION_STMT; non terminal EXPRESSION_LIST; non terminal CONDITITONAL_EXPRESSION; non terminal OR_TEST; non terminal AND_TEST; non terminal NOT_TEST; non terminal COMPARISON; non terminal COMP_OPERATOR; non terminal OR_EXPR; non terminal XOR_EXPR; non terminal AND_EXPR; IDENTIFIER ::=LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :}| LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} DIGIT; LETTER ::= LOWERCASE | UPPERCASE; COMPOUND_STMT ::=WHILE_STMT; WHILE_STMT ::= WHILE{: System.out.printf( "while"); :} EXPRESSION COMA {: System.out.printf(":"); :} SUITE ELSE {: System.out.printf("else" ); :} COMA{: System.out.printf( ":" ); :} SUITE |WHILE{: System.out.printf( "while" ); :} EXPRESSION COMA{: System.out.printf( ":" ); :} SUITE; SUITE ::= STMT_LIST NEWLINE{: System.out.printf( "newline" ); :}; STMT_LIST ::= SIMPLE_STMT SEMCOLON{: System.out.printf( ";" ); :} SIMPLE_STMT STMT_LIST|SEMCOLON{: System.out.printf( ";" ); :}; SIMPLE_STMT ::=EXPRESSION_STMT; EXPRESSION_STMT ::=EXPRESSION_LIST; EXPRESSION_LIST ::= EXPRESSION CAMMA{: System.out.printf( "," ); :} EXPRESSION EXPRESSION_LIST| CAMMA{: System.out.printf( "," ); :}; EXPRESSION ::= CONDITITONAL_EXPRESSION; CONDITITONAL_EXPRESSION ::= OR_TEST IF{: System.out.printf( "if"); :} OR_TEST ELSE{: System.out.printf("else"); :} EXPRESSION |OR_TEST; OR_TEST ::= AND_TEST | OR_TEST OR{: System.out.printf( "or"); :} AND_TEST; AND_TEST ::= NOT_TEST | AND_TEST AND{: System.out.printf( "and"); :} NOT_TEST; NOT_TEST ::= COMPARISON | NOT{: System.out.printf("not"); :} NOT_TEST; COMPARISON ::= OR_EXPR COMP_OPERATOR OR_EXPR ; COMP_OPERATOR ::= LESS{: System.out.printf( "<"); :} | GREATER{: System.out.printf(">"); :} | EQUAL{: System.out.printf("=="); :} | GREATERorE{: System.out.printf(">="); :} | LESSorE{: System.out.printf("<="); :} | NEQUAL{: System.out.printf("!="); :}; OR_EXPR ::= XOR_EXPR | OR_EXPR OROP{: System.out.printf("|"); :} XOR_EXPR; XOR_EXPR ::= AND_EXPR | XOR_EXPR XOROP {: System.out.printf("^"); :}XOR_EXPR; AND_EXPR ::= ANDOP{: System.out.printf("&"); :} | AND_EXPR; can any one told me how can solve this errors to build parser correcrtly??

    Read the article

  • How to properly close a UDT server in Netty 4

    - by Steffen
    I'm trying to close my UDT server (Netty 4.0.5.Final) with shutDownGracefully() and reopen it on the same port. Unfortunately, I always get the socket exception below although it waits until the future has completed. I also added the socket option SO_REUSEADDR. What is the proper way to do this? Exception in thread "main" com.barchart.udt.ExceptionUDT: UDT Error : 5011 : another socket is already listening on the same UDP port : listen0:listen [id: 0x323d3939] at com.barchart.udt.SocketUDT.listen0(Native Method) at com.barchart.udt.SocketUDT.listen(SocketUDT.java:1136) at com.barchart.udt.net.NetServerSocketUDT.bind(NetServerSocketUDT.java:66) at io.netty.channel.udt.nio.NioUdtAcceptorChannel.doBind(NioUdtAcceptorChannel.java:71) at io.netty.channel.AbstractChannel$AbstractUnsafe.bind(AbstractChannel.java:471) at io.netty.channel.DefaultChannelPipeline$HeadHandler.bind(DefaultChannelPipeline.java:1006) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.ChannelDuplexHandler.bind(ChannelDuplexHandler.java:38) at io.netty.handler.logging.LoggingHandler.bind(LoggingHandler.java:254) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.DefaultChannelPipeline.bind(DefaultChannelPipeline.java:848) at io.netty.channel.AbstractChannel.bind(AbstractChannel.java:193) at io.netty.bootstrap.AbstractBootstrap$2.run(AbstractBootstrap.java:321) at io.netty.util.concurrent.SingleThreadEventExecutor.runAllTasks(SingleThreadEventExecutor.java:354) at io.netty.channel.nio.NioEventLoop.run(NioEventLoop.java:366) at io.netty.util.concurrent.SingleThreadEventExecutor$2.run(SingleThreadEventExecutor.java:101) at java.lang.Thread.run(Thread.java:724) A small test program demonstration the problem: public class MsgEchoServer { public static class MsgEchoServerHandler extends ChannelInboundHandlerAdapter { } public void run() throws Exception { final ThreadFactory acceptFactory = new UtilThreadFactory("accept"); final ThreadFactory connectFactory = new UtilThreadFactory("connect"); final NioEventLoopGroup acceptGroup = new NioEventLoopGroup(1, acceptFactory, NioUdtProvider.MESSAGE_PROVIDER); final NioEventLoopGroup connectGroup = new NioEventLoopGroup(1, connectFactory, NioUdtProvider.MESSAGE_PROVIDER); try { final ServerBootstrap boot = new ServerBootstrap(); boot.group(acceptGroup, connectGroup) .channelFactory(NioUdtProvider.MESSAGE_ACCEPTOR) .option(ChannelOption.SO_BACKLOG, 10) .option(ChannelOption.SO_REUSEADDR, true) .handler(new LoggingHandler(LogLevel.INFO)) .childHandler(new ChannelInitializer<UdtChannel>() { @Override public void initChannel(final UdtChannel ch) throws Exception { ch.pipeline().addLast(new MsgEchoServerHandler()); } }); final ChannelFuture future = boot.bind(1234).sync(); } finally { acceptGroup.shutdownGracefully().syncUninterruptibly(); connectGroup.shutdownGracefully().syncUninterruptibly(); } new MsgEchoServer().run(); } public static void main(final String[] args) throws Exception { new MsgEchoServer().run(); } }

    Read the article

  • Passing an object as parameter from Andriod to web service using ksoap

    - by user3718626
    I have an object called User which implements KvmSerializable. Would like to pass this object to the webservice. PropertyInfo pi = new PropertyInfo(); pi.setName("obj"); pi.setValue(user); pi.setType(user.getClass()); request.addProperty(pi); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.setOutputSoapObject(request); envelope.addMapping(NAMESPACE, "User",User.class); HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); I get the following error.... SoapFault - faultcode: 'soapenv:Server' faultstring: 'Unknow type {http://users.com}User' faultactor: 'null' detail: org.kxml2.kdom.Node@53263024 at org.ksoap2.serialization.SoapSerializationEnvelope.parseBody(SoapSerializationEnvelope.java:141) at org.ksoap2.SoapEnvelope.parse(SoapEnvelope.java:140) at org.ksoap2.transport.Transport.parseResponse(Transport.java:118) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:272) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:118) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:113) at com.compete.WebServiceCallTask.getQuestion(WebServiceCallTask.java:114) at com.compete.WebServiceCallTask.doInBackground(WebServiceCallTask.java:53) at com.compete.WebServiceCallTask.doInBackground(WebServiceCallTask.java:1) at android.os.AsyncTask$2.call(AsyncTask.java:287) at java.util.concurrent.FutureTask.run(FutureTask.java:234) at android.os.AsyncTask$SerialExecutor$1.run(AsyncTask.java:230) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1080) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:573) at java.lang.Thread.run(Thread.java:856) Appreciate if any one can point me to an sample code or can direct me what is the issue. Thanks.

    Read the article

  • Errors when deleting SQlite row

    - by SagiLow
    When i call my func for deleting a row from my DB : public void deleteRow(int rowId) { getWritableDatabase().delete(DatabaseHelper.orderTable, "id="+rowId,null); i get a lot of error messages in the logcat : 06-02 16:32:14.356: E/WindowManager(2770): Activity com.Sagi.MyOrders.FindOrder has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@44f50540 that was originally added here 06-02 16:32:14.356: E/WindowManager(2770): android.view.WindowLeaked: Activity com.Sagi.MyOrders.FindOrder has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@44f50540 that was originally added here 06-02 16:32:14.356: E/WindowManager(2770): at android.view.ViewRoot.<init>(ViewRoot.java:247) 06-02 16:32:14.356: E/WindowManager(2770): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 06-02 16:32:14.356: E/WindowManager(2770): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 06-02 16:32:14.356: E/WindowManager(2770): at android.view.Window$LocalWindowManager.addView(Window.java:424) 06-02 16:32:14.356: E/WindowManager(2770): at android.app.Dialog.show(Dialog.java:241) 06-02 16:32:14.356: E/WindowManager(2770): at com.Sagi.MyOrders.FindOrder.alert_editlist(FindOrder.java:56) 06-02 16:32:14.356: E/WindowManager(2770): at com.Sagi.MyOrders.FindOrder.onItemLongClick(FindOrder.java:138) 06-02 16:32:14.356: E/WindowManager(2770): at android.widget.AbsListView.performLongPress(AbsListView.java:1753) 06-02 16:32:14.356: E/WindowManager(2770): at android.widget.AbsListView.access$600(AbsListView.java:72) 06-02 16:32:14.356: E/WindowManager(2770): at android.widget.AbsListView$CheckForLongPress.run(AbsListView.java:1711) 06-02 16:32:14.356: E/WindowManager(2770): at android.os.Handler.handleCallback(Handler.java:587) 06-02 16:32:14.356: E/WindowManager(2770): at android.os.Handler.dispatchMessage(Handler.java:92) 06-02 16:32:14.356: E/WindowManager(2770): at android.os.Looper.loop(Looper.java:123) 06-02 16:32:14.356: E/WindowManager(2770): at android.app.ActivityThread.main(ActivityThread.java:4627) 06-02 16:32:14.356: E/WindowManager(2770): at java.lang.reflect.Method.invokeNative(Native Method) 06-02 16:32:14.356: E/WindowManager(2770): at java.lang.reflect.Method.invoke(Method.java:521) 06-02 16:32:14.356: E/WindowManager(2770): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:868) 06-02 16:32:14.356: E/WindowManager(2770): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:626) 06-02 16:32:14.356: E/WindowManager(2770): at dalvik.system.NativeStart.main(Native Method) I looked for a cursor left open or a DB but there is nothing i could find. right after the function returns, there is : finish(); Thanks you !!!

    Read the article

  • Any way to turn off quips in OOWeb?

    - by Misha Koshelev
    http://ooweb.sourceforge.net/tutorial.html Not really a question, but I can't seem to stop writing stuff like this. Maybe someone will find it useful. I know rewriting an HTTP server is not the way to turn off the quips ;) /* Copyright 2010 Misha Koshelev. All Rights Reserved. */ package com.mksoft.common; import java.io.BufferedReader; import java.io.InputStreamReader; import java.io.IOException; import java.io.PrintWriter; import java.io.UnsupportedEncodingException; import java.net.URLDecoder; import java.text.SimpleDateFormat; import java.util.Date; import java.util.LinkedHashMap; import java.net.ServerSocket; import java.net.Socket; /** * Simple HTTP Server. * * @author Misha Koshelev */ public class HttpServer extends Thread { /* * Constants */ /** * 404 Not Found Result */ protected final static String result404NotFound="<html><head><title>404 Not Found</title></head><body bgcolor='#ffffff'><h1>404 Not Found</h1></body></html>"; /* * Variables */ /** * Port on which HTTP server handles requests. */ protected int port; public int getPort() { return port; } public void setPort(int _port) { port=_port; } /* * Constructors */ public HttpServer(int _port) { setPort(_port); } /* * Helpers */ /** * Errors */ protected void error(String message) { System.err.println(message); System.err.flush(); } /** * Debugging */ protected boolean debugOutput=true; protected void debug(String message) { if (debugOutput) { error(message); } } /** * Lock object */ private Object lock=new Object(); /** * Should we quit? */ protected boolean doQuit=false; /** * Are we done? */ protected boolean areWeDone=false; /** * Process POST request headers */ protected String processPostRequest(String url,LinkedHashMap<String,String> headers,String inputLine) { debug("HttpServer.processPostRequest: url=\""+url); if (debugOutput) { for (String key: headers.keySet()) { debug("HttpServer.processPostRequest: headers."+key+"=\""+headers.get(key)+"\""); } } debug("HttpServer.processPostRequest: inputLine=\""+inputLine+"\""); try { inputLine=new URLDecoder().decode(inputLine,"UTF-8"); } catch (UnsupportedEncodingException uee) { uee.printStackTrace(); } String[] keyValues=inputLine.split("&"); LinkedHashMap<String,String> post=new LinkedHashMap<String,String>(); for (int i=0;i<keyValues.length;i++) { String keyValue=keyValues[i]; int equals=keyValue.indexOf('='); String key=keyValue.substring(0,equals); String value=keyValue.substring(equals+1); post.put(key,value); } return post(url,headers,post); } /** * Server loop (here for exception handling purposes) */ protected void serverLoop() throws IOException { /* Start server socket */ ServerSocket serverSocket=null; try { serverSocket=new ServerSocket(getPort()); } catch (IOException ioe) { ioe.printStackTrace(); System.exit(1); } Socket clientSocket=null; while (true) { /* Quit if necessary */ if (doQuit) { break; } /* Accept incoming connections */ try { clientSocket=serverSocket.accept(); } catch (IOException ioe) { ioe.printStackTrace(); System.exit(1); } /* Read request */ BufferedReader in=null; String inputLine=null; String firstLine=null; String blankLine=null; LinkedHashMap<String,String> headers=new LinkedHashMap<String,String>(); try { in=new BufferedReader(new InputStreamReader(clientSocket.getInputStream())); while (true) { if (blankLine==null) { inputLine=in.readLine(); } else { /* POST request, read Content-length bytes */ int contentLength=new Integer(headers.get("Content-Length")).intValue(); StringBuilder sb=new StringBuilder(contentLength); for (int i=0;i<contentLength;i++) { sb.append((char)in.read()); } inputLine=sb.toString(); break; } if (firstLine==null) { firstLine=inputLine; } else if (blankLine==null) { if (inputLine.equals("")) { if (firstLine.startsWith("GET ")) { break; } blankLine=inputLine; } else { int colon=inputLine.indexOf(": "); String key=inputLine.substring(0,colon); String value=inputLine.substring(colon+2); headers.put(key,value); } } } } catch (IOException ioe) { ioe.printStackTrace(); } /* Process request */ String result=null; firstLine=firstLine.replaceAll(" HTTP/.*",""); if (firstLine.startsWith("GET ")) { result=get(firstLine.replaceFirst("GET ",""),headers); } else if (firstLine.startsWith("POST ")) { result=processPostRequest(firstLine.replaceFirst("POST ",""),headers,inputLine); } else { error("HttpServer.ServerLoop: Unhandled request \""+firstLine+"\""); } debug("HttpServer.ServerLoop: result=\""+result+"\""); /* Send response */ PrintWriter out=null; try { out=new PrintWriter(clientSocket.getOutputStream(),true); } catch (IOException ioe) { ioe.printStackTrace(); } if (result!=null) { out.println("HTTP/1.1 200 OK"); } else { out.println("HTTP/1.0 404 Not Found"); result=result404NotFound; } Date now=new Date(); out.println("Date: "+new SimpleDateFormat("EEE, d MMM yyyy HH:mm:ss z").format(now)); out.println("Content-Type: text/html; charset=UTF-8"); out.println("Content-Length: "+result.length()); out.println(""); out.print(result); /* Clean up */ out.close(); if (in!=null) { in.close(); } clientSocket.close(); } serverSocket.close(); areWeDone=true; synchronized(lock) { lock.notifyAll(); } } /* * Methods */ /** * Run server on port specified in constructor. */ public void run() { try { serverLoop(); } catch (IOException ioe) { ioe.printStackTrace(); System.exit(1); } } /** * Process GET request (should be overwritten). */ public String get(String url,LinkedHashMap<String,String> headers) { debug("HttpServer.get: url=\""+url+"\""); if (debugOutput) { for (String key: headers.keySet()) { debug("HttpServer.get: headers."+key+"=\""+headers.get(key)+"\""); } } if (url.equals("/")) { return "<html><head><title>HttpServer GET Test Page</title></head>\r\n"+ "<body bgcolor='#ffffff'>\r\n"+ "<center><h1>HttpServer GET Test Page</h1></center>\r\n"+ "<hr />\r\n"+ "<center><table>\r\n"+ "<form method='post' action='/'>\r\n"+ "<tr><td align=right>Test 1:</td>\r\n"+ " <td><input type='text' name='text 1' value='test me !!! !@#$'></td></tr>\r\n"+ "<tr><td align=right>Test 2:</td>\r\n"+ " <td><input type='text' name='text 2' value='type smthng'></td></tr>\r\n"+ "<tr><td>&nbsp;</td>\r\n"+ " <td align=right><input type='submit' value='Submit'></td></tr>\r\n"+ "</form>\r\n"+ "</table></center>\r\n"+ "<hr />\r\n"+ "<center><a href='/quit'>Shutdown Server</a></center>\r\n"+ "</html>"; } else if (url.equals("/quit")) { quit(); return ""; } else { return null; } } /** * Process POST request (should be overwritten). */ public String post(String url,LinkedHashMap<String,String> headers,LinkedHashMap<String,String> post) { debug("HttpServer.post: url=\""+url+"\""); if (debugOutput) { for (String key: headers.keySet()) { debug("HttpServer.post: headers."+key+"=\""+headers.get(key)+"\""); } } if (url.equals("/")) { String result="<html><head><title>HttpServer Post Test Page</title></head>\r\n"+ "<body bgcolor='#ffffff'>\r\n"+ "<center><h1>HttpServer Post Test Page</h1></center>\r\n"+ "<hr />\r\n"+ "<center><table>\r\n"+ "<tr><th>Key</th><th>Value</th></tr>\r\n"; for (String key: post.keySet()) { result+="<tr><td align=right>"+key+"</td><td align=left>"+post.get(key)+"</td></tr>\r\n"; } result+="</table></center>\r\n"+ "</html>"; return result; } else { return null; } } /** * Wait for server to quit. */ public void waitForCompletion() { while (areWeDone==false) { synchronized(lock) { try { lock.wait(); } catch (InterruptedException ie) { } } } } /** * Shutdown server. */ public void quit() { doQuit=true; } }

    Read the article

  • repaint problem

    - by user357816
    I have a problem with my repaint in the method move. I dont know what to doo, the code is below import java.awt.*; import java.io.*; import java.text.*; import java.util.*; import javax.sound.sampled.*; import javax.swing.*; import javax.swing.Timer; import java.awt.event.*; import java.lang.*; public class bbb extends JPanel { public Stack<Integer> stacks[]; public JButton auto,jugar,nojugar; public JButton ok,ok2; public JLabel info=new JLabel("Numero de Discos: "); public JLabel instruc=new JLabel("Presiona la base de las torres para mover las fichas"); public JLabel instruc2=new JLabel("No puedes poner una pieza grande sobre una pequenia!"); public JComboBox numeros=new JComboBox(); public JComboBox velocidad=new JComboBox(); public boolean seguir=false,parar=false,primera=true; public int n1,n2,n3; public int click1=0; public int opcion=1,tiempo=50; public int op=1,continuar=0,cont=0; public int piezas=0; public int posx,posy; public int no; public bbb() throws IOException { stacks = new Stack[3]; stacks[0]=new Stack<Integer>(); stacks[1]=new Stack<Integer>(); stacks[2]=new Stack<Integer>(); setPreferredSize(new Dimension(1366,768)); ok=new JButton("OK"); ok.setBounds(new Rectangle(270,50,70,25)); ok.addActionListener(new okiz()); ok2=new JButton("OK"); ok2.setBounds(new Rectangle(270,50,70,25)); ok2.addActionListener(new vel()); add(ok2);ok2.setVisible(false); auto=new JButton("Automatico"); auto.setBounds(new Rectangle(50,80,100,25)); auto.addActionListener(new a()); jugar=new JButton("PLAY"); jugar.setBounds(new Rectangle(100,100,70,25)); jugar.addActionListener(new play()); nojugar=new JButton("PAUSE"); nojugar.setBounds(new Rectangle(100,150,70,25)); nojugar.addActionListener(new stop()); setLayout(null); info.setBounds(new Rectangle(50,50,170,25)); info.setForeground(Color.white); instruc.setBounds(new Rectangle(970,50,570,25)); instruc.setForeground(Color.white); instruc2.setBounds(new Rectangle(970,70,570,25)); instruc2.setForeground(Color.white); add(instruc);add(instruc2); add(jugar);add(nojugar);jugar.setVisible(false);nojugar.setVisible(false); add(info); info.setVisible(false); add(ok); ok.setVisible(false); add(auto); numeros.setBounds(new Rectangle(210,50,50,25)); numeros.addItem(1);numeros.addItem(2);numeros.addItem(3);numeros.addItem(4);numeros.addItem(5); numeros.addItem(6);numeros.addItem(7);numeros.addItem(8);numeros.addItem(9);numeros.addItem(10); add(numeros); numeros.setVisible(false); velocidad.setBounds(new Rectangle(150,50,100,25)); velocidad.addItem("Lenta"); velocidad.addItem("Intermedia"); velocidad.addItem("Rapida"); add(velocidad); velocidad.setVisible(false); } public void Mover(int origen, int destino) { for (int i=0;i<3;i++) { System.out.print("stack "+i+": "); for(int n : stacks[i]) System.out.print(n+";"); System.out.println(""); } System.out.println("de <"+origen+"> a <"+destino+">"); stacks[destino].push(stacks[origen].pop()); System.out.println(""); this.validate(); this.repaint( ); } public void hanoi(int origen, int destino, int cuantas) { while (parar) {} if (cuantas <= 1) Mover(origen,destino); else { hanoi(origen,3 - (origen+destino),cuantas-1); Mover(origen,destino); hanoi(3 - (origen+destino),destino,cuantas-1); } } public void paintComponent(Graphics g) { ImageIcon fondo= new ImageIcon("fondo.jpg"); g.drawImage(fondo.getImage(),0, 0,1366,768,null); g.setColor(new Color((int)(Math.random() * 254), (int)(Math.random() *255), (int)(Math.random() * 255))); g.fillRect(0,0,100,100); g.setColor(Color.white); g.fillRect(150,600,250,25); g.fillRect(550,600,250,25); g.fillRect(950,600,250,25); g.setColor(Color.red); g.fillRect(270,325,10,275); g.fillRect(270+400,325,10,275); g.fillRect(270+800,325,10,275); int x, y,top=0; g.setColor(Color.yellow); x=150;y=580; for(int ii:stacks[0]) { g.fillRect(x+((ii*125)/10),y-(((ii)*250)/10),((10-ii)*250)/10,20);} x=550;y=580; for(int ii:stacks[1]) {g.fillRect(x+((ii*125)/10),y-(((ii)*250)/10),((10-ii)*250)/10,20);} x=950;y=580; for(int ii:stacks[2]) {g.fillRect(x+((ii*125)/10),y-(((ii)*250)/10),((10-ii)*250)/10,20);} System.out.println("ENTRO"); setOpaque(false); } private class play implements ActionListener //manual { public void actionPerformed(ActionEvent algo) { parar=false; if(primera=true) { hanoi(0,2,no); primera=false; } } } private class stop implements ActionListener //manual { public void actionPerformed(ActionEvent algo) { parar=true; } } private class vel implements ActionListener //manual { public void actionPerformed(ActionEvent algo) { if (velocidad.getSelectedItem()=="Lenta") {tiempo=150;} else if (velocidad.getSelectedItem()=="Intermedia") {tiempo=75;} else tiempo=50; ok2.setVisible(false); jugar.setVisible(true); nojugar.setVisible(true); } } private class a implements ActionListener //auto { public void actionPerformed(ActionEvent algo) { auto.setVisible(false); info.setVisible(true); numeros.setVisible(true); ok.setVisible(true); op=3; } } private class okiz implements ActionListener //ok { public void actionPerformed(ActionEvent algo) { no=Integer.parseInt(numeros.getSelectedItem().toString()); piezas=no; if (no>0 && no<11) { info.setVisible(false); numeros.setVisible(false); ok.setVisible(false); for (int i=no;i>0;i--) stacks[0].push(i); opcion=2; if (op==3) { info.setText("Velocidad: ");info.setVisible(true); velocidad.setVisible(true); ok2.setVisible(true); } } else { } repaint(); } } } the code of the other class that calls the one up is below: import java.awt.*; import java.io.*; import java.net.URL; import javax.imageio.*; import javax.swing.*; import javax.swing.border.*; import java.lang.*; import java.awt.event.*; public class aaa extends JPanel { private ImageIcon Background; private JLabel fondo; public static void main(String[] args) throws IOException { JFrame.setDefaultLookAndFeelDecorated(true); final JPanel cp = new JPanel(new BorderLayout()); JFrame frame = new JFrame ("Torres de Hanoi"); frame.setDefaultCloseOperation (JFrame.EXIT_ON_CLOSE); frame.setSize(550,550); frame.setVisible(true); bbb panel = new bbb(); frame.getContentPane().add(panel); frame.pack(); frame.setVisible(true); } }

    Read the article

  • How-to call server side Java from JavaScript

    - by frank.nimphius
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The af:serverListener tag in Oracle ADF Faces allows JavaScript to call into server side Java. The example shown below uses an af:clientListener tag to invoke client side JavaScript in response to a key stroke in an Input Text field. The script then call a defined af:serverListener by its name defined in the type attribute. The server listener can be defined anywhere on the page, though from a code readability perspective it sounds like a good idea to put it close to from where it is invoked. <af:inputText id="it1" label="...">   <af:clientListener method="handleKeyUp" type="keyUp"/>   <af:serverListener type="MyCustomServerEvent"                      method="#{mybean.handleServerEvent}"/> </af:inputText> The JavaScript function below reads the event source from the event object that gets passed into the called JavaScript function. The call to the server side Java method, which is defined on a managed bean, is issued by a JavaScript call to AdfCustomEvent. The arguments passed to the custom event are the event source, the name of the server listener, a message payload formatted as an array of key:value pairs, and true/false indicating whether or not to make the call immediate in the request lifecycle. <af:resource type="javascript">     function handleKeyUp (evt) {    var inputTextComponen = event.getSource();       AdfCustomEvent.queue(inputTextComponent,                         "MyCustomServerEvent ",                         {fvalue:component.getSubmittedValue()},                         false);    event.cancel();}   </af:resource> The server side managed bean method uses a single argument signature with the argument type being ClientEvent. The client event provides information about the event source object - as provided in the call to AdfCustomEvent, as well as the payload keys and values. The payload is accessible from a call to getParameters, which returns a HashMap to get the values by its key identifiers.  public void handleServerEvent(ClientEvent ce){    String message = (String) ce.getParameters().get("fvalue");   ...  } Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Find the tag library at: http://download.oracle.com/docs/cd/E15523_01/apirefs.1111/e12419/tagdoc/af_serverListener.html

    Read the article

  • QotD: Roger Yeung on Oracle's Java Uninstall Applet

    - by $utils.escapeXML($entry.author)
    We have a build of an Applet that will assist in the removal of older versions of the JRE. The Applet is available for testing on http://java.com/uninstall-tool . At this stage the Applet only targets the Windows platform, as it represents the largest installed base and the need for platform specific elements made Windows the logical starting point. We are deliberately not giving documentation on how to use the applet - we want feedback of the tool standing on its own.The intent of making this build available is to gather feedback; ideas, suggestions, comments, good and bad, what works, what does not work, what could be improved, etc. Please try it out and give us feedback to ensure a smooth release.Roger Yeung in a post with more details on providing feedback.

    Read the article

  • Tutoriel Java : Comprendre le fonctionnement de RMI (Remote Method Invocation), par Alain Defrance

    Bonjour, Le RMI (ou Remote Method Invocation) est très souvent utilisé, soit directement, soit dans des couches sous-jacentes. RMI est par exemple utilisé pour exposer des EJB SessionBeans. Notre objectif va être de démystifier RMI en comprenant ses méchanismes. Nous allons analyser comment une invocation à distance est possible en allant jusqu'a implémenter notre propre version allégée de RMI. Bien entendu, afin de nous focaliser sur les objectifs de cet article, certains prérequis sont nécessaires. Aucun rappel sur l'utilisation la gestion d'un réseau en Java ne sera fait. Article disponible ici : http://alain-defrance.developpez.com...2SE/micro-rmi/...

    Read the article

< Previous Page | 479 480 481 482 483 484 485 486 487 488 489 490  | Next Page >