Search Results

Search found 22613 results on 905 pages for 'variable length arguments'.

Page 485/905 | < Previous Page | 481 482 483 484 485 486 487 488 489 490 491 492  | Next Page >

  • Adding folder to Eclipse classpath

    - by Paul
    Hello, When i develop a project i create a folder in my project called libs. And in this folder i place all the library jars that i use. Is there a way to add just the libs folder to the class path so that i do not have to add each individual jar? I was thinking something along the lines of a variable or creating a user library. Many thanks.

    Read the article

  • Why is my (Type).GetFields(BindingFlags.Instance | BindingFlags.Public) not working?

    - by granadaCoder
    My code can see the NonPublic members, but not the Public ones. (???) Full sample code below. FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); is returning nothing. Note, I'm trying to get at the properties on the abstract class as well as the 1 concrete class. (And read the attributes as well). I'm going bonkers on this one....the msdn example works with the 2 flags (BindingFlags.Instance | BindingFlags.Public).....but my mini inheritance example below is not. THANKS in advance. /////////////START CODE private void RunTest1() { try { textBox1.Text = string.Empty; Type t = typeof(MyInheritedClass); //Look at the BindingFlags *** NonPublic *** int fieldCount = 0; while (null != t) { fieldCount += t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic).Length; FieldInfo[] nonPublicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic); foreach (FieldInfo field in nonPublicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); } } t = t.BaseType; } Console.WriteLine("\n\r------------------\n\r"); //Look at the BindingFlags *** Public *** t = typeof(MyInheritedClass); FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); foreach (FieldInfo field in publicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); object[] attributes = field.GetCustomAttributes(t, true); if (attributes != null && attributes.Length > 0) { foreach (Attribute att in attributes) { Console.WriteLine(att.GetType().Name); } } } } } catch (Exception ex) { ReportException(ex); } } private void ReportException(Exception ex) { Exception innerException = ex; while (innerException != null) { Console.WriteLine(innerException.Message + System.Environment.NewLine + innerException.StackTrace + System.Environment.NewLine + System.Environment.NewLine); innerException = innerException.InnerException; } } public abstract class MySuperType { public MySuperType(string st) { this.STString = st; } public string STString { get; set; } public abstract string MyAbstractString {get;set;} } public class MyInheritedClass : MySuperType { public MyInheritedClass(string ic) : base(ic) { this.ICString = ic; } [Description("This is an important property"),Category("HowImportant")] public string ICString { get; set; } private string _oldSchoolPropertyString = string.Empty; public string OldSchoolPropertyString { get { return _oldSchoolPropertyString; } set { _oldSchoolPropertyString = value; } } [Description("This is a not so importarnt property"), Category("HowImportant")] public override string MyAbstractString { get; set; } }

    Read the article

  • Data types for validation

    - by nevalu
    How to create a new data type which to can check/validate its schema when is created a new variable (of that type)? By example, to validate if a string has 20 characters, I tried: {{{ // Format: 2006-01-12T06:06:06Z func date(str string) { if len(str) != 20 { fmt.Println("error") } } var Date = date() type Account struct { domain string username string created Date } }}} but it faills because Date is not a type.

    Read the article

  • Incompatible pointer type

    - by Boffin
    Hello. I have the function with following signature: void box_sort(int**, int, int) and variable of following type: int boxes[MAX_BOXES][MAX_DIMENSIONALITY+1] When I am calling the function box_sort(boxes, a, b) GCC gives me two warnings: 103.c:79: warning: passing argument 1 of ‘box_sort’ from incompatible pointer type (string where i am calling the function) 103.c:42: note: expected ‘int **’ but argument is of type ‘int (*)[11] (string where the function is defined) The question is why? Whether int x[][] and int** x (and actually int* x[]) are not the same types in C?

    Read the article

  • How to use substring in vbscript within a xsl page.

    - by dipesh
    I am trying to replace the double quotes in a string with a single quote, got the following code but get error message saying "Object Required strLocation" Sub UpdateAdvancedDecisions(strLocation) Dim d Dim strLLength strLLength = Len(strLocation) - 1 For d = 0 To strLLength alert strLocation strValue = strLocation.Substring(2,3) If strLocation.substring(d,d+1)=" " " Then strLLength = strLLength.substring(0, d) + "'" + strLLength.substring(d + 1,strLLength.length) Next End Sub

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Ruby hash value truthiness and symbols

    - by John Topley
    Could somebody please explain why the variable named foo remains true in the code below, even though it's set to false when the method is called? And why the symbol version behaves as expected? def test(options = {}) foo = options[:foo] || true bar = options[:bar] || :true puts "foo is #{foo}, bar is #{bar}" end >> test(:foo => false, :bar => :false) foo is true, bar is false I've only tried this using Ruby 1.8.7.

    Read the article

  • Get the layout mode (landscape or portrait) of a pdf from php/linux

    - by Jonathan Hendler
    Given a PDF, how can one get the layout mode of a PDF (or relative width/height) using a PHP lib or linux command line tool? Using http://www.tecnick.com/public/code/cp%5Fdpage.php?aiocp%5Fdp=tcpdf which can set this variable on new PDFs, but for existing pdfs from adobe. Thought of converting pdfs to ps, or using gs in some other way - like converting it to an image first, and getting the width and height of that. Is this the best way?

    Read the article

  • Theme the node-create and node-edit template

    - by Toxid
    I'm using drupal 6. I've managed to make a .tpl file for one content type, that is for images in my image gallery. I did that by adding this code in template.php: function artbasic_theme($existing, $type, $theme, $path) { return array( 'galleryimage_node_form' => array( 'arguments' => array('form' => NULL), 'template' => 'galleryimage_node_form' ) ); } And then I created galleryimage_node_form.tpl.php, and was good to go. Now it happens so that I want to have other template files for the forms of other content types, for example link_contrib_node_form.tpl.php. I've tried a couple of ways to change this function to include more content types, but I can't figure it out. Can anyone help?

    Read the article

  • textbox issue regarding shrinking first time input text

    - by picnic4u
    i have a problem regarding the textbox. i have done the textbox auto expandable but when i insert the text first time then the textbox shrink in size from their original size.but my requirement is that when my text is exceeding the text box length then it auto expand. my code is <script type="text/javascript"> $(document).ready(function() { $('.txtStyle').autogrow(); }); </script> pls somebody suggest how ot is possible

    Read the article

  • Call function based off of a string in Lisp

    - by powerj1984
    I am passing in command line arguments to my Lisp program and they are formatted like this when they hit my main function: ("1 1 1" "dot" "2 2 2") I have a dot function and would like to call it directly from the argument, but this isn't possible because something like (funcall (second args)...) receives "dot" and not dot as the function name. I tried variations of this function: (defun remove-quotes (s) (setf (aref s 0) '"")) to no avail, before realizing that the quotes were not really a part of the string. Is there a simple way to do this, or should I just check each string and then call the appropriate function? Thanks!

    Read the article

  • How to get the textbox value in php?

    - by Nitz
    On my page. i have one textbox and one button. -- on the button click event. -- one function will be called. Now, How to get that value of textbox and store in php variable? this should be done in that function which we will call on button click.

    Read the article

  • How do I restrict accepting only one type in my generic method?

    - by kunjaan
    I have a generic function foo, which accepts any type and prints them out. public static <T> T foo(T... arg) { List<T> foo = Arrays.asList(arg); for (T t : foo) { System.out.println(t); } return null; } How do I make sure that the arguments received are of only 1 type. For example, {1,'a',3} should be invalid. It should either be all numbers or all characters.

    Read the article

  • Building a decision-making game in jQuery? Where would I store data....

    - by redconservatory
    I built a slideshow/decision-making game in Flash but would like to try to redo it using jQuery. The slideshow part seems simple enough, however I have a series of user decisions that I'm not sure how to approach. In flash, if the user makes a decision, I would just store this in a variable or shared local objects, is this the same for jQuery? i.e. mix regular javascript variables with the jQuery?

    Read the article

  • Getting a substring in Ruby by x number of chars

    - by wotaskd
    I'm trying to produce some Ruby code that will take a string and return a new one, with a number x number of characters removed from its end - these can be actual letters, numbers, spaces etc. Ex: given the following string a_string = "a1wer4zx" I need a simple way to get the same string, minus - say - the 3 last digits. In the case above, that would be "a1wer". The way I'm doing it right now seems very convoluted: an_array = a_string.split(//,(a_string.length-2)) an_array.pop new_string = an_array.join Any ideas?

    Read the article

  • Push SVG String into Dom?

    - by Colin
    I have a javascript variable that basically looks like this: my_svg_image = '<circle cx="227.58331298828125" cy="102" r="3" style="fill:black;stroke-width:0" />'; It was loaded from my database. Is there a way I can parse that string and add it to the DOM with Javascript? I have svgweb set up, but don't see how I can get it to parse this string. Are there other libraries that might help?

    Read the article

  • Collections in C#

    - by Oghenero
    am converting a vb.net component to c#, i get this error Using the generic type 'System.Collections.ObjectModel.Collection<T>' requires '1' type arguments This is what i did in VB.NET i had this Private _bufferCol As Collection i did this in c# private Collection _bufferCol = new Collection(); My declaration is using Microsoft.VisualBasi; using System.Collections; using System.Collections.Generic; using System.ComponentModel; using System.Collections.ObjectModel; Can any body help me please.

    Read the article

  • accessing variables declared outside the asp code

    - by sushant
    <script ID="clientEventHandlersVBS" LANGUAGE="vbscript"> s=pass() y=s </script> <% session("password")=y Response.write(session("password")) Response.write(y) %> i have this code. but nothing is getting stored inside the session variable neither anything is getting printed. cant i access the variables declared outside the asp code or is their any syntax mistake. any help is really appreciated

    Read the article

  • Own params to PeriodicTask run() method in Celery

    - by Alex Isayko
    Hello to all! I am writing a small Django application and I should be able to create for each model object its periodical task which will be executed with a certain interval. I'm use for this a Celery application, but i can't understand one thing: class ProcessQueryTask(PeriodicTask): run_every = timedelta(minutes=1) def run(self, query_task_pk, **kwargs): logging.info('Process celery task for QueryTask %d' % query_task_pk) task = QueryTask.objects.get(pk=query_task_pk) task.exec_task() return True Then i'm do following: >>> from tasks.tasks import ProcessQueryTask >>> result1 = ProcessQueryTask.delay(query_task_pk=1) >>> result2 = ProcessQueryTask.delay(query_task_pk=2) First call is success, but other periodical calls returning the error - TypeError: run() takes exactly 2 non-keyword arguments (1 given) in celeryd server. So, can i pass own params to PeriodicTask run() ? Thanks!

    Read the article

< Previous Page | 481 482 483 484 485 486 487 488 489 490 491 492  | Next Page >