Search Results

Search found 18347 results on 734 pages for 'generate password'.

Page 512/734 | < Previous Page | 508 509 510 511 512 513 514 515 516 517 518 519  | Next Page >

  • Problem with migrating a model in ruby

    - by Shreyas Satish
    I run script/generate model query edit query.rb in models.. class Query < ActiveRecord::Base #I even tried Migrations instead of Base def sef.up create table :queries do|t| t.string :name end end def self.down drop_table :queries end end ,run rake db:migrate. and what I see in db is this: mysql> desc queries; +------------+----------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+----------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | created_at | datetime | YES | | NULL | | | updated_at | datetime | YES | | NULL | | +------------+----------+------+-----+---------+----------------+ Where is the "name" field? HELP ! Cheers !

    Read the article

  • xsl with javascript

    - by Vignesh
    I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

    Read the article

  • Entity Framework: Data Centric vs. Object Centric

    - by Eric J.
    I'm having a look at Entity Framework and everything I'm reading takes a data centric approach to explaining EF. By that I mean that the fundamental relationships of the system are first defined in the database and objects are generated that reflect those relationships. Examples Quickstart (Entity Framework) Using Entity Framework entities as business objects? The EF documentation implies that it's not necessary to start from the database layer, e.g. Developers can work with a consistent application object model that can be mapped to various storage schemas When designing a new system (simplified version), I tend to first create a class model, then generate business objects from the model, code business layer stuff that can't be generated, and then worry about persistence (or rather work with a DBA and let him worry about the most efficient persistence strategy). That object centric approach is well supported by ORM technologies such as (n)Hibernate. Is there a reasonable path to an object centric approach with EF? Will I be swimming upstream going that route? Any good starting points?

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • Question on Win32 LogonUser API and the Logon Type

    - by Lalit_M
    We have developed a ASP.NET web application and has implemented a custom authentication solution using active directory as the credentials store. Our front end application uses a normal login form to capture the user name and password and leverages the Win32 LogonUser method to authenticate the user’s credentials. When we are calling the LogonUser method, we are using the LOGON32_LOGON_NETWORK as the logon type. The issue we have found is that user profile folders are being created under the C:\Users folder of the web server. The folder seems to be created when a new user who has never logged on before is logging in for the first time. As the number of new users logging into the application grows, disk space is shrinking due to the large number of new user folders getting created. Has anyone seen this behavior with the Win32 LogonUser method? Does anyone know how to disable this behavior?

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • Consuming an RPC/encoded Web Service in .NET

    - by Timmy O' Tool
    I'm trying to build the proxy class for a web service using the wsdl Executing this command: wsdl [http://WSDL_URL] I'm getting Warning: This web reference does not conform to WS-I Basic Profile v1.1. R2706: A wsdl:binding in a DESCRIPTION MUST use the value of "literal" for the use attribute in all soapbind:body, soapbind:fault, soapbind:header and soapbind:headerfault elements. ... Error: Cannot find definition for http://schemas.xmlsoap.org/wsdl/:BouBinding. Service Description with namespace http://schemas.xmlsoap.org/wsdl/ is missing. Parameter name: name The author of the web service told me that the SOAP protocol is RPC/encoded. Is there is any way to generate a proxy class for this?

    Read the article

  • Setting post tags in wordpress via XMLRPC API when submitting a post?

    - by aviv
    Hi, I am trying to use WordPress API via XMLRPC to submit new posts. But i can't set the post tags (nor the categories). echo "Adding $term to blog via XMLRPC ..."; $client = new IXR_Client("http://$blog.wordpress.com/xmlrpc.php"); $content = array('title'=>$term, 'description'=>"All about $term", 'category'=>'barvaz,moshe', 'tags'=>'tag1,tag2'); $client->query('metaWeblog.newPost', 0, $username, $password, $content, true); $rv = $client->getResponse(); print_r($rv); Any idea?

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

  • Echo autoincrement id doubt

    - by Marcelo
    Hi, can I print the id, even if it's autoincrement ? Because the way I'm doing I'm using an empty variable for id. $id= ""; mysql_connect(localhost,$username,$password); @mysql_select_db($database) or die ("Não conectou com a base $database"); mysql_query("INSERT INTO table1(id,...) VALUES ('".$id."',....)") or die(mysql_error()); mysql_close(); echo "Your id is :"; echo "".$id; I'm trying to print the id, but it's coming blank. I checked the table and there's an id number there. How can I print it then at? Thanks for the attention

    Read the article

  • Odd Series of Packets, How would I reproduce this behavior?

    - by JustSmith
    I recorded a series of http packets that I cant programmatically recreate. The series of packets goes like this: HTTP GET /axis-cgi/admin/param.cgi?action=list&group=Network.eth0.MACAddress,Properties.System.SerialNumber,DVTelTest,SightLogix.ProdShortName HTTP/1.1 HTTP HTTP/1.1 200 OK (text/plain) HTTP GET /axis-cgi/admin/param.cgi?action=list&group=Properties.Image.Resolution HTTP/1.1 HTTP HTTP/1.1 200 OK (text/plain) HTTP GET /axis-cgi/admin/param.cgi?action=update&Network.RTSP.ProtViewer=password HTTP/1.1 HTTP GET /axis-cgi/admin/param.cgi?action=list&group=Event HTTP/1.1 HTTP HTTP/1.1 200 OK (text/plain) HTTP GET /axis-cgi/admin/param.cgi?action=list&group=ImageSource.I0.Sensor HTTP/1.1 HTTP HTTP/1.1 200 OK (text/plain) Notice the two GET followed by one response. I though the two gets were going out at the same time but there is no corresponding number of responses. Also when trying to reproduce this pattern as the server if I abort the first GET request the client waits until it times out and starts the request over with out sending any other requests. What is happening here? How can I reproduce it?

    Read the article

  • Important Security Issue: Is it possible to put binary image data into html markup code and then get

    - by Joern Akkermann
    Hi, it's an important security issue and I'm sure this should be possible. A simple example: You run a community portal. Users are registered and upload their pictures. Your application gives security rules wenever a picture is allowed to be displayed. For example users must be friends on each sides by the system, in order that you can view someone elses uploaded pictures. Here comes the problem: it is possible that someone crawls the image directories of your server. But you want to protect your users from such attacks. If it's possible to put the binary data of an image directly into the html markup, you can restrict the user access of your image dirs the user and group your web application runs of and pass the image data to your apache user and group directly in the html. The only possible weakness then is the password of the user that your web app runs as. Is there already a possibility? Yours, Joern.

    Read the article

  • Adding file of the same name into the same list and unable to update name of the SPFile

    - by BeraCim
    Hi all: I'm having difficulties adding file of the same name in the same list and subsequently updating/changing/modifying the name of a SPFile. Basically, this is what I'm trying to do: string fileName = "something"; // obtained from a loop -- loop omitted here. SPFile file = folder.Files.Add(fileName, otherFile.OpenBinary()); The Add method will generate a runtime exception when it finds another file of the same name in the same list/folder. So I thought of changing the file name later in the process: string newGuid = Guid.NewGuid().ToString(); SPFile file = folder.Files.Add(newGuid, otherFile.OpenBinary()); // some other processing... afterwards, rename the file file.name = fileName; file.Item.Update(); A few minute of googling indicated I need to either move the file around, or update the name field by using ["Name"] instead. I was wondering are there any other better ways to get around this problem? Thanks.

    Read the article

  • Getting ssh to execute a command in the background on target machine

    - by dagorym
    This is a follow-on question to the How do you use ssh in a shell script? question. If I want to execute a command on the remote machine that runs in the background on that machine, how do I get the ssh command to return? When I try to just include the ampersand (&) at the end of the command it just hangs. The exact form of the command looks like this: ssh user@target "cd /some/directory; program-to-execute &" Any ideas? One thing to note is that logins to the the target machine always produce a text banner and I have ssh keys set up so no password is required.

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • Is there a standard practice for synchronizing SQL Server tables?

    - by EngineeringAutomation
    I've written an application that retrieves pricing and part options from a SQL database to generate a 3D Model of the product and create a sales proposal. My client likes it so much they want to be able to use it on laptops in the field now. The catch is, they won't have an internet connection. I'm considering setting up a SQLite database as part of the standard installation. The SQLite database on each laptop will synchronize with the main database when the internet connection is re-established. Are there best practices regarding synchronizing SQL tables like this? Are there any pitfalls I should consider? I'm open to all options. Thank you.

    Read the article

  • In native C++, how does one use a SqlCe .sdf database?

    - by Omer Sabic
    Is there a simple way, without .NET? I've found some libraries but none for SqlCe 3.5. There is http://sqlcehelper.codeplex.com/ but it's far from done, since a major feature like using a password is not yet implemented. I've looked at the source and it uses OLEdb to handle the database. The offical Microsoft Northwind example (that is shipped with SQL Compact 3.1, but not with 3.5) also doesn't work, I've tried setting it up with no success. Actually I don't have a sample working code. Was anyone able to set it up paired with a passworded .sdf? What are the alternatives? Thanks.

    Read the article

  • libnet that properly calculates checksum on IPV6

    - by VeaEm
    I have recently started playing around with libnet and using it to generate IPV6 packets. I am very new at programming, however, I am quite happy with the library. I have one problem with it though. It seems that libnet currently does not have the ability to properly calculate checksums on IPV6 packets. Being so new to programming, I am not yet capable of fixing this problem (although I am learning, so that one day I can). I am curious, has anyone run across a version of the library that can do this properly? Thanks!

    Read the article

  • Generating C++ BackTraces in OS/X (10.5.7)

    - by phillipwei
    I've been utilizing backtrace and backtrace_symbols to generate programmatic stack traces for the purposes of logging/diagnosis. It seems to roughly work, however, I'm getting a little bit of mangling and there are no accompanying file/line numbers associated with each function invocation (as I'd expect within a gdb bt call or something). Here's an example: 1 leonardo 0x00006989 _ZN9ExceptionC2E13ExceptionType + 111 2 leonardo 0x00006a20 _ZN9ExceptionC1E13ExceptionType + 24 3 leonardo 0x0000ab64 _ZN5Rules11ApplyActionER16ApplicableActionR9GameState + 1060 4 leonardo 0x0000ed15 _ZN9Simulator8SimulateEv + 2179 5 leonardo 0x0000eec9 _ZN9Simulator8SimulateEi + 37 6 leonardo 0x00009729 main + 45 7 leonardo 0x000025c6 start + 54 Anything I'm missing something, doing something silly, or is this all I can expect out of backtrace on OS/X? Some other tidbits: I don't see a rdynamic link option for the g++ version (4.0.1) I'm using. -g/-g3 doesn't make any difference. abi::__cxa__demangle doesn't seem to do anything

    Read the article

  • DTO and mapper generation from Domain Objects

    - by Nicolas
    I have plenty of java domain objects that I need to transform to DTOs. Please, don't start with the anti-pattern thing, the Domain Objects are what they are because of a long history, and I can't modify them (or not too much, see below). So, of course, we've passed the age of doing all that manually. I've looked around, and dozer seems the framework of choice for DTO mapping. But... what I'd really like is this: annotate classes and fields that I want in DTO, and run a tool that would generate the DTOs and the mappers. Does that sound too unreasonable? Does such a tool already exist?

    Read the article

  • C# SHA-1 vs. PHP SHA-1...Different Results?

    - by Arcdigital
    Hey, I am trying to calculate a SHA-1 Hash from a string, but when I calculate the string using php's sha1 function I get something different than when I try it in C#. I need C# to calculate the same string as PHP (since the string from php is calculated by a 3rd party that I cannot modify). How can I get C# to generate the same hash as PHP? Thanks!!! String = [email protected] C# Code (Generates d32954053ee93985f5c3ca2583145668bb7ade86) string encode = secretkey + email; UnicodeEncoding UE = new UnicodeEncoding(); byte[] HashValue, MessageBytes = UE.GetBytes(encode); SHA1Managed SHhash = new SHA1Managed(); string strHex = ""; HashValue = SHhash.ComputeHash(MessageBytes); foreach(byte b in HashValue) { strHex += String.Format("{0:x2}", b); } PHP Code (Generates a9410edeaf75222d7b576c1b23ca0a9af0dffa98) sha1();

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Servlet Session - switch from URL Rewriting to Cookie

    - by lajuette
    Situation: I have a "dumb" Javascript frontend that can contact some kind of SSO middleware (MW). The MW can obtain sessions by issuing requests that contain authentication credentials (username, password). I.e. the session will be created for a certain user. My frontend needs to "restart" the session to gain the user's permissions to the target system. For that i need a valid session cookie. The target system is not under my control (could be a more or less public WFS, WMS, etc.), so i cannot add any SSO mechanism to it. Question: Is it possible to "steal" a Session forging a request which URL contains a valid session ID in the jsessionid parameter? Goal : Issue such a request to a Servlet and make it respond with a Set-Cookie header that contains the same id. That way the frontend joins the session and may do whatever the user, which was used to create the session, is able to do.

    Read the article

  • Encode URL while send ajax

    - by meotimdihia
    I use cakePHP and it generate ajax /animemanga/animes/search/page:1?type%5B0%5D=3&amp;genre%5B0%5D=20&amp;genre%5B1%5D=4&amp;info%5B0%5D=episodes&amp;info%5B1%5D=released&amp;info%5B2%5D=rating&amp;info%5B3%5D=synopsis&amp;info%5B4%5D=completed&amp;info%5B5%5D=rating_count&amp;info%5B6%5D=name&amp;info%5B7%5D=id&amp;info%5B8%5D=name&amp;info%5B9%5D=id cakePHP encoded: & = &apm; will create error while use with Ajax. I use Jquery, browser Opera. how can this solve ?

    Read the article

< Previous Page | 508 509 510 511 512 513 514 515 516 517 518 519  | Next Page >