Search Results

Search found 18347 results on 734 pages for 'generate password'.

Page 510/734 | < Previous Page | 506 507 508 509 510 511 512 513 514 515 516 517  | Next Page >

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • I (think) I want to use a BItWise Operator to check useraccountcontrol property!

    - by Jim
    Hello, Here's some code: DirectorySearcher searcher = new DirectorySearcher(); searcher.Filter = "(&(objectClass=user)(sAMAccountName=" + lstUsers.SelectedItem.Text + "))"; SearchResult result = searcher.FindOne(); Within result.Properties["useraccountcontrol"] will be an item which will give me a value depending on the state of the account. For instance, a value of 66050 means I'm dealing with: A normal account; where the password does not expire;which has been disabled. Explanation here. What's the most concise way of finding out if my value "contains" the AccountDisable flag (which is 2) Thanks in advance!

    Read the article

  • Is there a nice XSL stylesheet for client-side DocBook rendering?

    - by Steven Huwig
    I want the DocBook documents in my SVN repository to look nice if someone looks at them in a web browser. I've started to write a CSS stylesheet, but I think that it will have significant limitations -- particularly ones regarding hyperlinks. There is a large body of DocBook XSL stylesheets at the DocBook site , but they don't seem to be appropriate for browser rendering. I don't want to generate static documents and put them into SVN. I want them to be basically readable for other developers without much hassle. I could write my own browser-appropriate XSL stylesheet to convert DocBook to HTML, but it seems like someone else must have already done this. I just don't know where to find it.

    Read the article

  • Generating unique N-valued key

    - by Bar
    Hi, StackOverflow! I want to generate unique random, N-valued key. This key can contain numbers and latin characters, i.e. A-Za-z0-9. The only solution I am thinking about is something like this (pseudocode): key = ""; smb = "ABC…abc…0123456789"; // allowed symbols for (i = 0; i < N; i++) { key += smb[rnd(0, smb.length() - 1)]; // select symbol at random position } Is there any better solution? What can you suggest? TIA, Michael.

    Read the article

  • Opinions Required: Custom HTML Markup from PHP with or without tag prefix.

    - by buggedcom
    I've created a class in PHP that allows you to create custom HTML markup. It basically works a bit like FB Markup or EE tags. It works off a tag prefix, so you can add tags like this. <ctag:pagination per_page="20" total="500" page="0" base="http://localhost/page?page={page}" mode="smart" adjecents="5" /> My question is: Is the markup above better than the markup below? I'm asking as I'm considering branching my code to rework the tag matching so you can just generate custom html elements. It would well for a drop in HTML5 replacement service. Match the User Agent for a none HTML5 browser and replace the HTML5 elements with your own replacements. <pagination per_page="20" total="500" page="0" base="http://localhost/page?page={page}" mode="smart" adjecents="5" /> PS, if anybody wants to look at the class I've put a download here.

    Read the article

  • C1083 : Permission denied on .sbr files

    - by speps
    Hello, I am using Visual Studio 2005 (with SP1) and I am getting weird errors concerning .sbr files. These files, as I read on MSDN, are intermediate files for BSCMAKE to generate a .bsc file. The errors I get are, for example (on different builds) : 11string.cpp : fatal error C1083: Impossible d'ouvrir le fichier généré(e) par le compilateur : '.\debug\String.sbr' : Permission denied 58type.cpp : fatal error C1083: Impossible d'ouvrir le fichier généré(e) par le compilateur : '.\Debug/Type.sbr' : Permission denied Translation : cannot open compiler intermediate file It seems to be consistent (I have at least 5 or 6 examples like this) with a .cpp file being compiled twice in the same project, respectively : 11String.cpp *some warnings, 2 lines* 11String.cpp 58Type.cpp *some warnings and other files compiled, a lot of lines* 58Type.cpp I already checked the .vcproj files for duplicate entries and it does not seem to be the problem. I would appreciate any help regarding this issue. Deactivating the build of .bsc files seems to be a workaround but maybe someone has better information than this. Thanks.

    Read the article

  • jQuery Plugin Overwriting Parameters

    - by Travis
    Hey Everyone, This maybe a very mundane question, but this is the first jQuery plugin that I write and I'm a bit fuzzy on understanding the scope rules in Javascript. I'm trying to write an simple jQuery plugin that wraps around the Stack Overflow API. I'm starting off by trying to work with the Flair API. I wanted to make the plugin as configurable as possible so that you can easily pass it the domain and user id, and generate multiple Flairs. var superUser = $.jStackOverflow.flair({domain:"superuser.com", id: 30162, parentId:'#su-flair'}); var stackOverflow = $.jStackOverflow.flair({domain:"stackoverflow.com", id: 55954, parentId:'#so-flair'}); The problem is, when it makes the second call, its somehow using the correct domain and id parameters, but the parentId field that it's using in the callback function to create the html, is using the first parameter. You can see the plugin here and the html here

    Read the article

  • Is there a free (as in beer) Flow chart generator for COBOL Code?

    - by btelles
    Hi I've never read COBOL in my life and have been tasked with rewriting the old COBOL code in a new language. Are there any free or free-to-try software packages out there that will generate a flow chart for a COBOL program? I've looked at "Visustin" and "Code Visual to Flowchart" Visustin blanks out part of the code and does random rotations in the demo version, which causes the demo to be less accurate. I couldn't get Code Visual Flow Chart to work correctly with our code. Know of any other packages I might try?

    Read the article

  • Accessing a module's action rendered output

    - by Flavius
    Hi. I'm writing an "Account" module which should take care of everything about accounts: registration, login/logout, user administration, password recovery, account activation, etc. So I thought it would be best to reuse whatever the module's DefaultController::actionRegister() generates to show on the main page. So my question is: how to create a new "sub request" (similar to CController::forward()) from any controller (either SiteController, read: from views/layouts/main.php, or another controller, eventually of another submodule) to a given module/controller/action? I've tried with $this-forward() from within my application layout without success: it shows a blank page, no error whatsoever. Thanks

    Read the article

  • Display continuous dates in Pivot Chart

    - by Douglas
    I have a set of data in a pivot table with date times and events. I've made a pivot chart with this data, and grouped the data by day and year, then display a count of events for each day. So, my horizontal axis goes from 19 March 2007 to 11 May 2010, and my vertical axis is numeric, going from zero to 140. For some days, I have zero events. These days don't seem to be shown on the horizontal axis, so 2008 is narrower than 2009. How do I display a count of zero for days with no events? I'd like my horizontal axis to be continuous, so that it does not miss any days, and every month ends up taking up the same amount of horizontal space. (This question is similar to the unanswered question here, but I'd rather not generate a table of all the days in the last x number of years just to get a smooth plot!)

    Read the article

  • A code using SharePoint classes doesn't run on systems not having SharePoint installed

    - by Manish
    I have a window application which uses SP classes to create a site. I works fine on a system having Windows Server 2003 R2 with sharepoint installed. But it doesn't work on a system having XP installed and SharePoint not installed. The fact is that both of these systems are on a intranet. So I assumed that the NON-SP system would be able to run the code and create a site on the system having SP installed if all the required parameters (like serverLocation, domain, username, password) are provided. I did copied the DLLs to these NON-SP system and referenced them to build the project: Microsoft.SharePoint.dll microsoft.sharepoint.portal.dll Microsoft.SharePoint.Publishing.dll But this too didn't worked. What am I missing? Is my assumption wrong?

    Read the article

  • mysql result set joining existing table

    - by Yang
    is there any way to avoid using tmp table? I am using a query with aggregate function (sum) to generate the sum of each product: the result looks like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_5 | 300 now i want to join the above result to another table called products. so that i will have a summary like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_3 | 0 product_4 | 0 product_5 | 300 i know 1 way of doing this is the dump the 1st query result to a temp table then join it with products table. is there a better way?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bash commands not executed when through cron job - PHP

    - by basicxman
    Hi there! I have a cron job running a PHP script every five minutes; the PHP script executes two bash commands at the end of the script. I know the script is running due to a log file it appends to. When I run the PHP script manually via the Ubuntu Gnome Terminal both bash commands execute flawlessly; however when the PHP script is triggered via cron, the two bash commands are not ran. Any ideas? $command = 'notify-send "' . count($infoleakPosts) . ' New Posts."'; `$command`; $command = 'firefox http://example.com'; `$command`; */1 * * * * php /home/andrew/grab.php USERNAME PASSWORD # JOB_ID_1

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • make website page get news articles from feeds

    - by Andy
    Hi, I would like to start publishing some news articles from time to time. An option would be to create a new web page for every article but this sounds like it can be done easier. For instance I noticed clear channel uses some kind of feed, like: http://www.z100.com/cc-common/news/sections/newsarticle.html?feed=104650&article=7011404 I don't know what it means and how it works but looks like a nice way to get the article from some kind of database I guess? Does someone knows how this works, or some other way to create new articles etc, some dynamical functionality for instance to generate links to the articles and get the right article from a database for example. thanks!

    Read the article

  • Oracle 10g - Best way to escape single quotes

    - by satynos
    I have to generate some update statements based off a table in our database. I created the following script which is generating the update statements I need. But when I try to run those scripts I am getting errors pertaining to unescaped single quotes in the content and &B, &T characters which have special meaning in oracle. I took care of the &B and &T problem by setting SET DEFINE OFF. Whats the best way to escape single quotes within the content? DECLARE CURSOR C1 IS SELECT * FROM EMPLOYEES; BEGIN FOR I IN C1 LOOP DBMS_OUTPUT.PUT_LINE('UPDATE EMPLOYEES SET FIRST_NAME= ''' || I.FIRST_NAME|| ''', LAST_NAME = ''' || I.LAST_NAME ''', DOB = ''' || I.DOB|| ''' WHERE EMPLOYEE_ID = ''' || I.EMPLOYEE_ID || ''';'); END LOOP; END; Here if the first_name or last_name contains single quotes then the generated update statements break. Whats the best way to escape those single quotes within the first_name and last_name?

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • Should boost library be dependent on structure member alignments?

    - by Sorin Sbarnea
    I found, the hard way, that at least boost::program_options is dependent of the compiler configured structure member alignment. If you build boost using default settings and link it with a project using 4 bytes alignment (/Zp4) it will fail at runtime (made a minimal test with program_options). Boost will generate an assert indicating a possible bad calling convention but the real reason is the structure member alignment. Is there any way to prevent this? If the alignment makes the code incompatible shouldn't this be included in library naming?

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • jQuery Sortable + Droppable z-index problem

    - by unknowndomain
    I am having a probelm with the z-index of my sortable object not being above my droppable. If you visit http://clareshilland.unknowndomain.co.uk/. Press Ctrl + L to bring up the login screen. Enter the username clare and the password shilland. It will then load in the admin bar and if you click manage gallery. A pop down thumbnail view will appear with all the photos from that gallery. The issue is that when you drag the 'polaroids' from the grid to the delete area they are under the delete area. I tried putting the delete area inside the same div as the grid but it makes no difference, I just don't know what to do at this point so any help would be a massive help!

    Read the article

  • Backing Up Database from Remote Server to Local in VB.NET

    - by Pradeep
    Hi, I am making a VB.NET application that can download/backup the database that is currently on a remote server. I have Remote Server IP,Username,Password and Database name. I am also able to connect to it. But i don't know what to do after connecting to it. I don't know what all files are need to be backed up. ( i think database and log file both must be backed up, i am not sure ) please let me know that basic commmands that i will need to backup the whole database. Thanks in advance.

    Read the article

  • How to design a class for managing file path ?

    - by remi bourgarel
    Hi All In my app, I generate some xml file for instance : "/xml/product/123.xml" where 123 is the product's id and 123.xml contains informations about this product. I also have "/xml/customer/123.xml" where 123.xml contains informations about the client ... 123 How can I manage these file paths : 1/ - I create the file path directly in the seralization method ? 2/ I create 2 static class : CustomerSerializationPathManager and ProductSerializationPathManager with 1 method : getPath(int customerID) and getPath(int productID) 3/ I create one static class : SerializationPathManager with 2 method : getCustomerPath(int customerID) and getProductPath(int productID) 4/ something else I'd prefer the solution 3 cause if I think there's only one reason to change this class : I change the root directory. So I'd like to have your thoughts about it... thx

    Read the article

  • Best way to Fingerprint and Verify html structure.

    - by Lukas Šalkauskas
    Hello there, I just want to know what is your opinion about how to fingerprint/verify html/links structure. The problem I want to solve is: fingerprint for example 10 different sites, html pages. And after some time I want to have possibility to verify them, so is, if site has been changed, links changed, verification fails, othervise verification success. My base Idea is to analyze link structure by splitting it in some way, doing some kind of tree, and from that tree generate some kind of code. But I'm still in brainstorm stage, where I need to discuss this with someone, and know other ideas. So any ideas, algos, and suggestions would be usefull.

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

< Previous Page | 506 507 508 509 510 511 512 513 514 515 516 517  | Next Page >