Search Results

Search found 48063 results on 1923 pages for 'how to create dynamically'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 530/1923 | < Previous Page | 526 527 528 529 530 531 532 533 534 535 536 537  | Next Page >

  • inline divs with hidden overflow

    - by Jim
    I want to create 3 divs side by side when only one of them is visible. -------------- -------------- -------------- | visible | | invisible | | invisible | | | | | | | -------------- -------------- -------------- In order to do this I have tried to create a wrapping div with a 100px width, and hidden overflow. What am I doing wrong? <div style="width:50px;height:349px; overflow:hidden"> <div style="display: inline;">first div</div> <div style="display: inline;">second div</div> <div style="display: inline;">third div</div> </div>

    Read the article

  • windows application or a website? please clear the confusion

    - by user287745
    am currently reading a book, which has explanation of making a social website. half way through i noticed that the images of the solution explorer given in the text, indicate that windowsformapplication[PROJECT] has been used instead of WebForms[create new website]! there are no webforms? how would the end result be a site? what is happening here?? note:- i have always made websites which needs hosting and be accessible from other computers using webforms[create new website] which has web.config file app_data etc..... please help thank you.

    Read the article

  • problem in basic implementation of MVVM pattern - Services

    - by netmajor
    I watch some video and read articles about MVVM pattern and start thinking how should I implement it in my Silverlight app. So at first I create Silverlight application. I think that for clear view I create 3 folders: View - for each user control page in my app, ViewModel - for c# class which will querying date and Model- Entity Data Model of my SQL Server or Oracle Database. And now I am confused, cause I want to implement *WCF/RIA Services/Web services* in my project. In which folder should I put in class of services? I see in examples that Services take date and filtering it and then output data was binding in View - so It looks as ViewModel. But I was sure that someone use Services in Model and that I want to do. But how? Can someone explain me implementing Services as Model? Is my point of view at MVVM is correctly?

    Read the article

  • Javascript array of href's

    - by Jason
    Hi, I am trying to create an array with different href's to then attach to 5 separate elements. This is my code: var link = new Array('link1', 'link2', 'link3', 'link4', 'link5'); $(document.createElement("li")) .attr('class',options.numericId + (i+1)) .html('<a rel='+ i +' href=\"page.php# + 'link'\">'+ '</a>') .appendTo($("."+ options.numericId)) As you can see I am trying to append these items from the array to the end of my page so each link will take the user to a different section of the page. But i have not been able to do this. Is there a way to to create elements with different links? I am new to javascript so I am sorry if this doesn't make a whole lot of sense. If anyone is confused by what i am asking here I can try to clarify if I get some feedback. Any solutions would be greatly appreciated. Thanks, jason

    Read the article

  • Entity Relationship Multiple 1:1's

    - by Evan
    I have an application where I have a generic object (table) called Hull. Each hull in the table is unique. I have another object that has three hulls, but they are specifically the Port_Hull, Center_Hull and Starboard_Hull. Rather than create a One to Many relationship, I was trying to create a one to one relationship for each one, but this results in numerous errors unless I make the relationship from Hull to Vessel one to many (which it is not). Any idea how I go about this, or should I abandon the concept and make the vessel to hull relationship one to many and deal with lists that always have three entries? p.s. Using uniqueidentifiers as many users can be adding records while disconnected. Hull Table HullID uniqueidentifier (primary key) plus bunch of hull data fields Vessel Table VesselID uniqueidentifier (primary key) MainHullID uniqueidentifier (tried as key and non-key) PortHullID uniqueidentifier StarboardHullID uniqueidentifier plus bunch of Vessel data fields

    Read the article

  • Creating a list of integers in XML for android.

    - by Leif Andersen
    I would like to create a list of Integers in the /res folder of an android project. However, I want those integers to point resources in /res/raw. So for example, I would like something like this: <?xml version="1.0" encoding="utf-8"?> <resources> <integer-array name="built_in_sounds"> <item>@raw/sound</item> </integer-array> </resources> But id doesn't look like I can do that, is there any way to do this? Or should I just create the list in a java class? Thank you

    Read the article

  • Drawing graphs in MS Excel somehow got complicated

    - by Ivan
    I want to draw several graphs and combine them into one figure. I will explain the problem in an example. Let's say that I want to draw two graphs with these points: Graph #1 (X and Y are defining a coordinate). X - Y _____ 1 - 5 2 - 5 5 - 7 9 - 10 Graph #2 X - Y _____ 6 - 8 8 - 12 9 - 7 12 - 8 15 - 11 21 - 11 What I do is that I create a chart and click on "Select Data". There I create two series and choose X and Y values. However, this doesn't work since it doesn't allow me to choose different X values for different graphs. Although I choose different for these two series, the second one is chosen for both. This is how it looks like in the end: Do you know how to fix this? I'm using Excel 2008 for Mac.

    Read the article

  • Redirecting to a diferent exe for download based on user agent

    - by Ra
    I own a Linux-Apache site where I host exe files for download. Now, when a user clicks this link to my site (published on another site): http://mysite.com/downloads/file.exe I need to dynamically check their user agent and redirect them to either http://mysite.com/downloads/file-1.exe or http://mysite.com/downloads/file-2.exe It seems to me that I have to options: Put a .htaccess file stating that .exe files should be considered to be scripts. Then write a script that checks the user agent and redirects to a real exe placed in another folder. Call this script file.exe. Use Apache mod-rewrite to point file.exe to redirect.php. Which of these is better? Any other considerations? Thanks.

    Read the article

  • Routing a location that matches one controller to another

    - by Luca Romagnoli
    Hi I have a controller named "places" with some actions like "view", "new", "create" When a user goes to mysite.com/places I want to execute the action "show" of another controller called "cores" So I've put this in the routes.rb file: map.connect '/:id/show', :controller => "cores", :action => "show" But it doesn't work. I receive this error: Processing PlacesController#show (for 127.0.0.1 at 2010-04-16 00:52:07) [GET] ActionController::UnknownAction (No action responded to show. Actions: admin_denied, admin_required, auto_complete_for_location, auto_complete_for_name, change_location, create, create_facebook_session, create_facebook_session_with_secret, edit, exist, facebook_params, facebook_session, facebook_session_expired, facebook_session_parameters, get_form, is_admin?, new, one_or_true, redirect_to, render_publisher_error, render_publisher_interface, render_publisher_response, set_facebook_session, top_redirect_to, update, wants_interface?, and zero_or_false): How can i do to map that action in another controller? thanks

    Read the article

  • Resources on wordpress theme-development

    - by Espenhh
    What are the best resources for Wordpress theme-development? I am currently in the phase of starting my own blog, and don't want to use one of the many free themes. I already have a theme for my website, so I want to read about best-practices. Any advice on how to get started would be very welcome :) I have now created my theme (wohoo!), and thought I should summarize the best resources I found. Lets see.. Resources: ThemeTation's three-part guide to create a wordpress-theme from scratch Nettuts.com's guide: How to Create a Wordpress Theme from Scratch (And Part 2) Didn't actually use this, it's a quite new article, but anyway - it's great. It will get a follow-up in the next few days too.. Wordpress.org's own guide on templates Definatly a must-read for everyone new to wordpress-designing.. "The loop" Essential knowledge, also a must-read Directory of all the template tags Used by wordpress to actually output blog-content.. Inspiration: Smashing Magazine's lists: first, one more, yet another one Wordpress.org's theme-directory

    Read the article

  • How to copy a cell's formatting using a formula?

    - by Alvin Lim
    For example, cell A1 contains the text "Hello World" which is in bold. In cell A2, I use the formula =A1. Therefore cell A2 now also contains "Hello World", but it is not in bold. How can I modify the formula to also copy the formatting (in this case, bold) of A1? A more complex example is strikethrough properties, i.e. A1 contains "Orange/Red". How do I show the same content in cell A2 dynamically, so that any changes made in A1 will update A2 as well?

    Read the article

  • Formating a text in a table cell with PHPWord e.g. bold, font, size e.t.c

    - by alphy
    I have the code snippet below //create a new word document $word= new PHPWord(); //create potrait orientation $section=$word->createSection(); $table = $section->addTable(); $word->addFontStyle('rStyle', array('bold'=>true, 'italic'=>true, 'size'=>16)); //header row $table->addRow(400, array('bgColor'=>'dbdbdb')); $table->addCell(2000, array('bgColor'=>'dbdbdb'))->addText('Cell 1','rStyle'); $table->addCell(3500, array('bgColor'=>'dbdbdb'))->addText('Cell 1'); $table->addCell(1500, array('bgColor'=>'dbdbdb'))->addText('Cell 1','rStyle'); $table->addCell(2000, array('bgColor'=>'dbdbdb'))->addText('Cell 1'); // Save File $objWriter = PHPWord_IOFactory::createWriter($word, 'Word2007'); $objWriter->save('Text.docx'); echo 'Text.docx created successfully'; } How can i add text formatting to a cell value to bold, italic, font-size etc, I have tried as shown above but it does not work

    Read the article

  • difference between DataContract attribute and Serializable attribute in .net

    - by samar
    I am trying to create a deep clone of an object using the following method. public static T DeepClone<T>(this T target) { using (MemoryStream stream = new MemoryStream()) { BinaryFormatter formatter = new BinaryFormatter(); formatter.Serialize(stream, target); stream.Position = 0; return (T)formatter.Deserialize(stream); } } This method requires an object which is Serialized i.e. an object of a class who is having an attribute "Serializable" on it. I have a class which is having attribute "DataContract" on it but the method is not working with this attribute. I think "DataContract" is also a type of serializer but maybe different than that of "Serializable". Can anyone please give me the difference between the two? Also please let me know if it is possible to create a deepclone of an object with just 1 attribute which does the work of both "DataContract" and "Serializable" attribute or maybe a different way of creating a deepclone? Please help!

    Read the article

  • C++: set of C-strings

    - by Nicholas
    I want to create one so that I could check whether a certain word is in the set using set::find However, C-strings are pointers, so the set would compare them by the pointer values by default. To function correctly, it would have to dereference them and compare the strings. I could just pass the constructor a pointer to the strcmp() function as a comparator, but this is not exactly how I want it to work. The word I might want to check could be part of a longer string, and I don't want to create a new string due to performance concerns. If there weren't for the set, I would use strncmp(a1, a2, 3) to check the first 3 letters. In fact, 3 is probably the longest it could go, so I'm fine with having the third argument constant. Is there a way to construct a set that would compare its elements by calling strncmp()? Code samples would be greatly appreciated.

    Read the article

  • CakePHP Bake association problem

    - by Apu
    I have only two tables in my database with a one-to-many relationship between them (user hasMany messages) and am trying to get basic CRUD functionality going. Bake detects the associations correctly and specifies them correctly inside the model classes, but in controllers and views it looks like Cake doesn't know anything about those associations -- I don't even get a select tag for user_id when I go add a new message. Has anyone come across this problem before? What can I be doing wrong? Table structure appears to be fine: CREATE TABLE users ( id int(11) NOT NULL AUTO_INCREMENT, username varchar(255) NOT NULL, `password` varchar(255) NOT NULL, email varchar(255) NOT NULL, created datetime NOT NULL, modified datetime NOT NULL, PRIMARY KEY (id) ) ENGINE=MyISAM DEFAULT CHARSET=utf8; CREATE TABLE IF NOT EXISTS `messages` ( `id` int(11) NOT NULL AUTO_INCREMENT, `user_id` int(11) NOT NULL, `content` varchar(255) NOT NULL, `created` datetime NOT NULL, `modified` datetime NOT NULL, PRIMARY KEY (`id`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;

    Read the article

  • How to build a distributable jar with Ant for a java project having external jar dependencies

    - by Nikunj Chauhan
    I have a Java project in Eclipse with class MainClass having main method in package : com.nik.mypackage. The project also references two external libraries, which I copied in the lib folder in Eclipse and then added to build path using ADD JAR function. The libraries being one.jar and two.jar This library is in lib folder in eclipse and added to the build path. I want to create a executable JAR of the application using ant script. So that user can access my application using command: c:>java -jar MyProject-20111126.jar I know about the Eclipse plugin which directly exports a java application as runnable JAR. But I want to learn ant and the build process so manually want to create the build.xm.

    Read the article

  • Clean Up Controller, Update Item Quantity within Cart

    - by Karl Entwistle
    Hi guys I was wondering if anyone could help me out, I need to clean up this controller as the resulting code to simply update an items quantity if it already exists seems way too complex. class LineItemsController < ApplicationController def create @product = Product.find(params[:product_id]) if LineItem.exists?(:cart_id => current_cart.id) item = LineItem.find(:first, :conditions => [ "cart_id = #{@current_cart.id}"]) LineItem.update(item.id, :quantity => item.quantity + 1) else @line_item = LineItem.create!(:cart => current_cart, :product => @product, :quantity => 1, :unit_price => @product.price) flash[:notice] = "Added #{@product.name} to cart." end redirect_to root_url end end ` As always any help is much appreciated, the code should be fairly self explanatory, thanks :) PS posted it here as well as it looks a bit funny on here http://pastie.org/994059

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • Possible: Set Operations on Disparate Maps with Same Key Type?

    - by Catskul
    Let's say I have two maps: typedef int Id; std::map<Id, std::string> idToStringMap; std::map<Id, double> idToDoubleMap; And let's say I would like to do a set operation on the keys of the two maps. Is there an easier way to do this than to create a custom "inserter" iterator? such that I could do something like: std::set<Id> resultSet; set_difference( idToStringMap.begin(), idToStringMap.end(), idToDoubleMap.begin(), idToDoubleMap.end(), resultSet.begin() ); My experimentation results imply that it will be necessary to create a custom inserter and perhaps a custom key comparer to do this, but I want for some insight/shortcut before doing so.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Inserting multiple types into an SQLite database with Python

    - by mankoff
    I'm trying to create an SQLite 3 database from Python. I have a few types I'd like to insert into each record: A float, and then 3 groups of n floats, currently a tuple but could be an array or list.. I'm not well-enough versed in Python to understand all the differences. My problem is the INSERT statement. DAS = 12345 lats = (42,43,44,45) lons = (10,11,12,13) times = (1,2,3,4,5,6,7,8,9) import sqlite3 connection = sqlite3.connect("test.db") cursor = connection.cursor() cursor.execute( "create table foo(DAS LONG PRIMARY KEY,lats real(4),lons real(4), times real(9) )" ) I'm not sure what comes next. Something along the lines of: cmd = 'INSERT into foo values (?,?,?,?), ..." cursor.execute(cmd) How should I best build the SQL insert command given this data?

    Read the article

  • How to generate GIR files from the Vala compiler?

    - by celil
    I am trying to create python bindings to a vala library using pygi with gobject introspection. However, I am having trouble generating the GIR files (that I am planning to compile to typelib files subsequently). According to the documentation valac should support generating GIR files. Compiling the following helloworld.vala public struct Point { public double x; public double y; } public class Person { public int age = 32; public Person(int age) { this.age = age; } } public int main() { var p = Point() { x=0.0, y=0.1 }; stdout.printf("%f %f\n", p.x, p.y); var per = new Person(22); stdout.printf("%d\n", per.age); return 0; } with the command valac helloworld.vala --gir=Hello-1.0.gir doesn't create the Hello-1.0.gir file as one would expect. How can I generate the gir file?

    Read the article

  • Knowledge for writing a compiler for Win32

    - by saf
    I have created an interpreter for my programming language (educational) and now I'd like to go one step further and create a compiler for it. I know that this is pretty hard work. What I already know is: I need to translate my input language to assembler A lot, isn't it? Now what I don't know is: What assembler do I need to create Win32 PE executables like, for example, Visual Studio does? What about file headers? I'd prefer not to use MASM but it seems like I'll have to. How to combine the assembler with my compiler?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 526 527 528 529 530 531 532 533 534 535 536 537  | Next Page >