Search Results

Search found 48063 results on 1923 pages for 'how to create dynamically'.

Page 531/1923 | < Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >

  • Android v1.5 w/ browser data storage

    - by Sirber
    I'm trying to build an offline web application which can sync online if the network is available. I tryed jQuery jStore but the test page stop at "testing..." whitout result, then I tryed Google Gears which is supposed to be working on the phone but it gears is not found. if (window.google && google.gears) { google.gears.factory.getPermission(); // Database var db = google.gears.factory.create('beta.database'); db.open('cominar-compteurs'); db.execute('create table if not exists Lectures' + ' (ID_COMPTEUR int, DATE_HEURE timestamp, kWh float, Wmax float, VAmax float, Wcum float, VAcum float);'); } else { alert('Google Gears non trouvé.'); } the code does work on Google Chrome v5.

    Read the article

  • How entity edit URL from within plug-in in MS Dyanmics CRM 4.0

    - by Greg McGuffey
    I would like to have a workflow create a task, then email the assigned user that they have a new task and include a link to the newly created task in the body of the email. I have client side code that will correctly create the edit URL, using the entities GUID and stores it in a custom attribute. However, when the task is created from within a workflow, the client script isn't run. So, I think a plug-in should work, but I can't figure out how to determine the URL of the CRM installation. I'm authoring this in a test environment and definitely don't want to have to change things when I move to production. I'm sure I could use a config file, but seems like the plug-in should be able to figure this out at runtime. Anyone have any ideas how to access the URL of the crm service from within a plug-in? Any other ideas? Thanks!

    Read the article

  • How to define a query om a n-m table

    - by user559889
    Hi, I have some troubles defining a query. I have a Product and a Category table. A product can belong to multiple categories and vice versa so there is also a Product-Category table. Now I want to select all products that belong to a certain category. But if the user does not provide a category I want all products. I try to create a query using a join but this results in the product being selected multiple times if it belongs to multiple categories (in the case no specific category is queried). What kind of query do I have to create? Thanks

    Read the article

  • Ember multiple property changes but want to trigger single event

    - by Ankur Agarwal
    I have a ArrayController for date picker with properties to and from. Now when user selects a new date range from the UI both to and from value changes. So a function which observers on to and from is trigger twice for a single change in date range. I want to trigger the function only one every date range change. Any suggestions how to do that with ember app = Ember.Application.create(); app.Time = Ember.ArrayController.create({ to: null, from: null, rootElement: "#time", debug1: function() { this.set('to', 1); this.set('from', 2); }, debug2: function() { this.setProperties( { 'to': 3, 'from': 4 }); }, debug3: function() { this.beginPropertyChanges(); this.set('to', 5); this.set('from', 6); this.endPropertyChanges(); }, search: function() { alert('called'); }.observes('to', 'from') }); View in JS Fiddle

    Read the article

  • Redirecting to a diferent exe for download based on user agent

    - by Ra
    I own a Linux-Apache site where I host exe files for download. Now, when a user clicks this link to my site (published on another site): http://mysite.com/downloads/file.exe I need to dynamically check their user agent and redirect them to either http://mysite.com/downloads/file-1.exe or http://mysite.com/downloads/file-2.exe It seems to me that I have to options: Put a .htaccess file stating that .exe files should be considered to be scripts. Then write a script that checks the user agent and redirects to a real exe placed in another folder. Call this script file.exe. Use Apache mod-rewrite to point file.exe to redirect.php. Which of these is better? Any other considerations? Thanks.

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • Maven2: Best practise for Enterprise Project (EAR file)

    - by Maik
    Hello everyone, I am just switching from Ant to Maven and am trying to figure out the best practice to set up a EAR file based Enterprise project? Lets say I want to create a pretty standard project with a jar file for the EJBs, a WAR file for the Web tier and the encapsulating EAR file, with the corresponding deployment descriptors. How would I go about it? Create the project with archetypeArtifactId=maven-archetype-webapp liek a war file and extend from there? What is the best project structure (and POM file example) for this? Where do you stick the ear file related deployment descriptors, etc? Thanks for any help.

    Read the article

  • Loading an OverlayView from XIB -vs- programmatically for use with UIImagePickerController

    - by PLG
    I am currently making a camera app for iPhone and I have a strange phenomenon that I can't figure out. I would appreciate some help understanding. When recreating an overlay view for passing to UIImagePickerController, I have been successfully been able to create the view programmatically. What I haven't been able to do is create the view with/without controller in IB, load it and pass it to the overlay pointer successfully. If I do it via IB, the view is not opaque and obscures the view of the camera completely. I can not figure out why. I was thinking that the normal view pointer might be assigned when loading from XIB and therefore overwrite the camera's view, but I have an example programmatically where view and overlayView are set equal in the controller class. Perhaps the load order is overwriting a pointer? Help would be appreciated... kind regards.

    Read the article

  • How to generate GIR files from the Vala compiler?

    - by celil
    I am trying to create python bindings to a vala library using pygi with gobject introspection. However, I am having trouble generating the GIR files (that I am planning to compile to typelib files subsequently). According to the documentation valac should support generating GIR files. Compiling the following helloworld.vala public struct Point { public double x; public double y; } public class Person { public int age = 32; public Person(int age) { this.age = age; } } public int main() { var p = Point() { x=0.0, y=0.1 }; stdout.printf("%f %f\n", p.x, p.y); var per = new Person(22); stdout.printf("%d\n", per.age); return 0; } with the command valac helloworld.vala --gir=Hello-1.0.gir doesn't create the Hello-1.0.gir file as one would expect. How can I generate the gir file?

    Read the article

  • Iterating Oracle collections of objects with out exploding them

    - by Scott Bailey
    I'm using Oracle object data types to represent a timespan or period. And I've got to do a bunch of operations that involve working with collections of periods. Iterating over collections in SQL is significantly faster than in PL/SQL. CREATE TYPE PERIOD AS OBJECT ( beginning DATE, ending DATE, ... some member functions...); CREATE TYPE PERIOD_TABLE AS TABLE OF PERIOD; -- sample usage SELECT <<period object>>.contains(period2) FROM TABLE(period_table1) t The problem is that the TABLE() function explodes the objects into scalar values, and I really need the objects instead. I could use the scalar values to recreate the objects but this would incur the overhead of re-instantiating the objects. And the period is designed to be subclassed so there would be additional difficulty trying to figure out what to initialize it as. Is there another way to do this that doesn't destroy my objects?

    Read the article

  • mvc 2.0 updatemodel and my ID Column

    - by femi
    Hello, I have created a create view within my MVC 2.0 Application and by default it included a field for the integer ID Column. This is definitely a field i do not need. If i remove the field and use updatemodel when trying to create the object in code, will something break because it doesnt see my ID column data being passed in, even though it is auto increment? Also, i noticed that in the NerdDinner example, updatemodel was used and after that the repository.save method was called. I thought that updatemodel would save the object to the database..why then call the .save method afterwards? Or have i missed something? Any help with this would be appreciated. Cheers

    Read the article

  • a question about rails general practice with REST, json, and ajax

    - by Nik
    Hi all, I have this question concerning REST I think: I have read a few rest tutorials and the feeling I get from them is that each action in a restful controller tends to be lean and almost single purpose: "Index gives off a collection of a model show gives off one model edit/new a prep place for changing/create a model update/create changes and makes new model deletes removes one model" After reading all these tutorials, rest seems to be to be a means to create an interface for a model, much like active resource type of thing. the mantra seems to be "controller provides data and data only and is also pretty convention over configuration, so expect projects_path to return a bunch of projects" I can understand that, and I like the cleanliness. But here's when I run into some trouble in reality in applying these guidelines: say three models, Project with attrib title, User with attrib name, and Location with attrib address. Say in views/users/index.html.erb, I want to use Ajax to fetch and display a project in a div#project_display when the user clicks on a project element, I know that I can use views/projects/show.js.rjs like this: page.replace_html 'project_display' "#{@project.name}" where in the projects_controller.rb def show @project = Project.find(params[:id]) repsond_to do |format| format.js and other formats... end end I have no problem in doing that for a couple of years now. BUT doesn't that mean that my JS response for the project#show action is LOCkED to present data to div#project_display element and show only whatever I that rjs template says it should show? That's very limiting and doesn't sound very "interface" like. I have never used JSON before or much XML, so I thought, maybe the JS response should send back raw stuff, like JSON and somehow the page on which the ajax request was called has the instruction on what do to with these raw data. That sounds a lot more flexible, doesn't it? Because look back at that exmpale, what if in the views/locations/index.html.erb, I want to do the exact same thing except I want to put the response in div#project_goes_here and the response should be #{project.name} I know this is a trivial change but that's the point: the RJS only allows one template at a time. So I think the JSON route is the way to go, but how does the already loaded page, the one that the ajax call came from, know when or how to "look forward" to incoming data? I read that PrototypeJS has this template thing, I wouldn't mind using it with JSON, but if you can demonstrate this or other means for displaying received-from-ajax data, I am all attention. Thank You

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to use correctly the Query Window in SQL Server 2008

    - by Richard77
    Hello, What should I do to avoid that commands be executed each time I hit 'Execute !. icon' I mean this USE master; GO CREATE DATABASE Sales GO USE Sales; GO CREATE TABLE Customers( CustomerID int NOT NULL, LName varchar (50) NOT NULL, FName varchar (50) NULL, Status varchar (10), ModifiedBy varchar (30) NULL ) GO When I click Execute!, Sql Server tries to redo the same thing. What I do for now is to delete the Query Window completely then write what I need before clicking the Execute icon. But, I doubt that I should be doing that. What can I do to keep writing the commands without having each time to clear the Query Window? Thanks for helping

    Read the article

  • Java Node.cloneNode()

    - by Tom Brito
    Talking about the org.w3c.dom package; When I call Node.cloneNode() method from a Element(extends Node) object, which Document is used to create the new cloned Element? Example: import org.w3c.dom; class MyClass { public static void main(String[] args) throws Exception { DocumentBuilder builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); Document doc = builder.newDocument(); Element element = doc.createElement("myElement"); Element cloneElement = (Element) element.cloneNode(true); } } Which Document was used to create cloneElement?

    Read the article

  • How to get LAN ip to a variable in a Windows batch file

    - by Ville Koskinen
    I'm streaming audio from my Windows 7 laptop to a sound card attached to a router. I have a little batch script to start streaming. REM Kill any instances of vlc taskkill /im vlc.exe "c:\Program Files\VideoLAN\VLC\vlc.exe" <parameters to start http streaming> REM Wait for vlc TIMEOUT /T 10 REM start playback on router plink -ssh [email protected] -pw password killall -9 madplay plink -ssh [email protected] -pw password wget -q -O - http://192.1.159:8080/audio | madplay -Q --no-tty-control - & As you see the http stream is hard coded. It would be nice to get the address dynamically to reuse the script on other machines. Any ideas?

    Read the article

  • Creating an SQL Compact file: Template or script?

    - by David Veeneman
    I am writing an application that writes to SQL Compact files that have a specific schema, and I am now implementing the New File use case. The simplest approach seems to be to use a Template pattern: first, create a template file that lives in the application directory. Then, when the user selects New File, the template is copied to the name and destination specified by the user in a New File dialog. The alternative is a scripted approach: Use the same New File dialog, but dispense with the template file. Instead, create an empty SQL Compact file using the name/destination specified by the user, and then execute a T-SQL script on it from managed code. At this point, I am leaning toward the Template approach, because it is simpler. Is there any reason I should not use that approach? Thanks for your help.

    Read the article

  • Mercurial setup: One central repo or several?

    - by Robert S.
    My company is switching from Subversion to Mercurial. We're using .NET for our product. We have a solution with about a dozen projects that are separate modules with no dependencies on each other. We're using a central repo on a server with push/pull for our integration build. I'm trying to figure out if I should create one central repo with all the projects in it, or if I should create a separate repo for each project. One argument for separate repos is that branching the individual modules would be easier, but an argument for a single repo is easier management and workflow. I'm very new to hg and DVCS, so some guidance is greatly appreciated.

    Read the article

  • Virtual camera/direct show filter for network stream

    - by Jeje
    Hi guys, i'm working with Flash Live Encoder. It's using camera for streaming video. Support forum say's that i can create custom direct show filter and stream data that i need. I cann't understand how direct show filter will display in the source list of the live encoder. I've tryed to use some commercial virtual camera and it work's fine, but it cann't use source from network stream. Summary. I have a several network streams. I think that i must to create virtual camera for each one. But if i find examples with direct show filter on C#, i cann't find for virtual camera.

    Read the article

  • Problem on jboss lookup entitymanager

    - by Stefano
    I have my ear-project deployed in jboss 5.1GA. From webapp i don't have problem, the lookup of my ejb3 work fine! es: ShoppingCart sc= (ShoppingCart) (new InitialContext()).lookup("idelivery-ear-1.0/ShoppingCartBean/remote"); also the iniection of my EntityManager work fine! @PersistenceContext private EntityManager manager; From test enviroment (I use Eclipse) the lookup of the same ejb3 work fine! but the lookup of entitymanager or PersistenceContext don't work!!! my good test case: public void testClient() { Properties properties = new Properties(); properties.put("java.naming.factory.initial","org.jnp.interfaces.NamingContextFactory"); properties.put("java.naming.factory.url.pkgs","org.jboss.naming:org.jnp.interfaces"); properties.put("java.naming.provider.url","localhost"); Context context; try{ context = new InitialContext(properties); ShoppingCart cart = (ShoppingCart) context.lookup("idelivery-ear-1.0/ShoppingCartBean/remote"); // WORK FINE } catch (Exception e) { e.printStackTrace(); } } my bad test : EntityManagerFactory emf = Persistence.createEntityManagerFactory("idelivery"); EntityManager em = emf.createEntityManager(); //test1 EntityManager em6 = (EntityManager) new InitialContext().lookup("java:comp/env/persistence/idelivery"); //test2 PersistenceContext em3 = (PersistenceContext)(new InitialContext()).lookup("idelivery/remote"); //test3 my persistence.xml <persistence-unit name="idelivery" transaction-type="JTA"> <jta-data-source>java:ideliveryDS</jta-data-source> <properties> <property name="hibernate.hbm2ddl.auto" value="create-drop" /><!--validate | update | create | create-drop--> <property name="hibernate.dialect" value="org.hibernate.dialect.MySQL5InnoDBDialect" /> <property name="hibernate.show_sql" value="true" /> <property name="hibernate.format_sql" value="true" /> </properties> </persistence-unit> my datasource: <datasources> <local-tx-datasource> <jndi-name>ideliveryDS</jndi-name> ... </local-tx-datasource> </datasources> I need EntityManager and PersistenceContext to test my query before build ejb... Where is my mistake?

    Read the article

  • WPF (irc) chat log control

    - by user408952
    I'm trying to learn WPF and was thinking about creating a simple IRC client. The most complicated part is to create the chat log. I want it to look more or less like the one in mIRC: or irssi: The important parts are that the text should be selectable, lines should wrap and it should be able to handle quite large logs. The alternatives that I can come up with are: StackPanel inside a ScrollViewer where each line is a row ListView, since that seems more suitable for dynamic content/data binding. Create an own control that does the rendering on its own. Is there any WPF guru out there that has some ideas on which direction to take and where to start?

    Read the article

< Previous Page | 527 528 529 530 531 532 533 534 535 536 537 538  | Next Page >