Search Results

Search found 81412 results on 3257 pages for 'file search'.

Page 55/3257 | < Previous Page | 51 52 53 54 55 56 57 58 59 60 61 62  | Next Page >

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Sunspot / Solr full text search - how to index Rails associations

    - by Sam
    Is it possible to index through an association with Sunspot? For example, if a Customer has_many Contacts, I want a 'searchable' block on my Customer model that indexes the Contact#first_name and Contact#last_name columns for use in searches on Customer. acts_as_solr has an :include option for this. I've simply been combining the associated column names into a text field on Customer like shown below, but this doesn't seem very flexible. searchable do text :organization_name, :default_boost => 2 text :billing_address1, :default_boost => 2 text :contact_names do contacts.map { |contact| contact.to_s } end Any suggestions?

    Read the article

  • Alpha Beta Search

    - by Becky
    I'm making a version of Martian Chess in java with AI and so far I THINK my move searching is semi-working, it seems to work alright for some depths but if I use a depth of 3 it returns a move for the opposite side...now the game is a bit weird because when a piece crosses half of the board, it becomes property of the other player so I think this is part of the problem. I'd be really greatful if someone could look over my code and point out any errors you think are there! (pls note that my evaluation function isn't nearly complete lol) MoveSearch.java public class MoveSearch { private Evaluation evaluate = new Evaluation(); private int blackPlayerScore, whitePlayerScore; public MoveContent bestMove; public MoveSearch(int blackScore, int whiteScore) { blackPlayerScore = blackScore; whitePlayerScore = whiteScore; } private Vector<Position> EvaluateMoves(Board board) { Vector<Position> positions = new Vector<Position>(); for (int i = 0; i < 32; i++) { Piece piece = null; if (!board.chessBoard[i].square.isEmpty()) { // store the piece piece = board.chessBoard[i].square.firstElement(); } // skip empty squares if (piece == null) { continue; } // skip the other players pieces if (piece.pieceColour != board.whosMove) { continue; } // generate valid moves for the piece PieceValidMoves validMoves = new PieceValidMoves(board.chessBoard, i, board.whosMove); validMoves.generateMoves(); // for each valid move for (int j = 0; j < piece.validMoves.size(); j++) { // store it as a position Position move = new Position(); move.startPosition = i; move.endPosition = piece.validMoves.elementAt(j); Piece pieceAttacked = null; if (!board.chessBoard[move.endPosition].square.isEmpty()) { // if the end position is not empty, store the attacked piece pieceAttacked = board.chessBoard[move.endPosition].square.firstElement(); } // if a piece is attacked if (pieceAttacked != null) { // append its value to the move score move.score += pieceAttacked.pieceValue; // if the moving pieces value is less than the value of the attacked piece if (piece.pieceValue < pieceAttacked.pieceValue) { // score extra points move.score += pieceAttacked.pieceValue - piece.pieceValue; } } // add the move to the set of positions positions.add(move); } } return positions; } // EvaluateMoves() private int SideToMoveScore(int score, PieceColour colour) { if (colour == PieceColour.Black){ return -score; } else { return score; } } public int AlphaBeta(Board board, int depth, int alpha, int beta) { //int best = -9999; // if the depth is 0, return the score of the current board if (depth <= 0) { board.printBoard(); System.out.println("Score: " + evaluate.EvaluateBoardScore(board)); System.out.println(""); int boardScore = evaluate.EvaluateBoardScore(board); return SideToMoveScore(boardScore, board.whosMove); } // fill the positions with valid moves Vector<Position> positions = EvaluateMoves(board); // if there are no available positions if (positions.size() == 0) { // and its blacks move if (board.whosMove == PieceColour.Black) { if (blackPlayerScore > whitePlayerScore) { // and they are winning, return a high number return 9999; } else if (whitePlayerScore == blackPlayerScore) { // if its a draw, lower number return 500; } else { // if they are losing, return a very low number return -9999; } } if (board.whosMove == PieceColour.White) { if (whitePlayerScore > blackPlayerScore) { return 9999; } else if (blackPlayerScore == whitePlayerScore) { return 500; } else { return -9999; } } } // for each position for (int i = 0; i < positions.size(); i++) { // store the position Position move = positions.elementAt(i); // temporarily copy the board Board temp = board.copyBoard(board); // make the move temp.makeMove(move.startPosition, move.endPosition); for (int x = 0; x < 32; x++) { if (!temp.chessBoard[x].square.isEmpty()) { PieceValidMoves validMoves = new PieceValidMoves(temp.chessBoard, x, temp.whosMove); validMoves.generateMoves(); } } // repeat the process recursively, decrementing the depth int val = -AlphaBeta(temp, depth - 1, -beta, -alpha); // if the value returned is better than the current best score, replace it if (val >= beta) { // beta cut-off return beta; } if (val > alpha) { alpha = val; bestMove = new MoveContent(alpha, move.startPosition, move.endPosition); } } // return the best score return alpha; } // AlphaBeta() } This is the makeMove method public void makeMove(int startPosition, int endPosition) { // quick reference to selected piece and attacked piece Piece selectedPiece = null; if (!(chessBoard[startPosition].square.isEmpty())) { selectedPiece = chessBoard[startPosition].square.firstElement(); } Piece attackedPiece = null; if (!(chessBoard[endPosition].square.isEmpty())) { attackedPiece = chessBoard[endPosition].square.firstElement(); } // if a piece is taken, amend score if (!(chessBoard[endPosition].square.isEmpty()) && attackedPiece != null) { if (attackedPiece.pieceColour == PieceColour.White) { blackScore = blackScore + attackedPiece.pieceValue; } if (attackedPiece.pieceColour == PieceColour.Black) { whiteScore = whiteScore + attackedPiece.pieceValue; } } // actually move the piece chessBoard[endPosition].square.removeAllElements(); chessBoard[endPosition].addPieceToSquare(selectedPiece); chessBoard[startPosition].square.removeAllElements(); // changing piece colour based on position if (endPosition > 15) { selectedPiece.pieceColour = PieceColour.White; } if (endPosition <= 15) { selectedPiece.pieceColour = PieceColour.Black; } //change to other player if (whosMove == PieceColour.Black) whosMove = PieceColour.White; else if (whosMove == PieceColour.White) whosMove = PieceColour.Black; } // makeMove()

    Read the article

  • Binary Search Tree in Java

    - by John R
    I want to make a generic BST, that can be made up of any data type, but i'm not sure how I could add things to the tree, if my BST is generic. All of my needed code is below. I want my BST made up of Locations, and sorted by the x variable. Any help is appreciated. Major thanks for looking. public void add(E element) { if (root == null) root = element; if (element < root) add(element, root.leftChild); if (element > root) add(element, root.rightChild); else System.out.println("Element Already Exists"); } private void add(E element, E currLoc) { if (currLoc == null) currLoc = element; if (element < root) add(element, currLoc.leftChild); if (element > root) add(element, currLoc.rightChild); else System.out.println("Element Already Exists); } Other Code public class BinaryNode<E> { E BinaryNode; BinaryNode nextBinaryNode; BinaryNode prevBinaryNode; public BinaryNode() { BinaryNode = null; nextBinaryNode = null; prevBinaryNode = null; } } public class Location<AnyType> extends BinaryNode { String name; int x,y; public Location() { name = null; x = 0; y = 0; } public Location(String newName, int xCord, int yCord) { name = newName; x = xCord; y = yCord; } public int equals(Location otherScene) { return name.compareToIgnoreCase(otherScene.name); } }

    Read the article

  • Anyone has implemented SMA* search algorithm?

    - by Endy
    I find the algorithm description in AIMA (Artificial Intelligence: A Modern Approach) is not correct at all. What does 'necessary' mean? What is the memory limit? The queue size or processed nodes? What if the current node has no children at all? I am wondering if this algorithm itself is correct or not. Because I searched the Internet and nobody has implemented it yet. Thanks.

    Read the article

  • jqGrid search/filter data api

    - by McLovin
    I've already read all available documentation and I cannot find a solution. I have a calendar outside of the grid which on click returns a date. All I need to do is filter my jqGrid based on that date. Can someone point me to the correct API method? Thanks!

    Read the article

  • Best practice No1: inline search layout across browsers

    - by Sixfoot Studio
    Ok, I have managed to fix my version of this example using a multitude of hacks and I would like to see how others would tackle this problem making this cross-browser compatible without too many hacks. <div class="searchDiv"> <img src="Images/left.gif" class="left" height="19" width="3" /> <input id="TextBox" type="text" class="searchField" /> <img src="Images/right.gif" height="19"width="3" class="right" /> <a href="" class="submit">Submit</a> <img src="Images/box-arrow.gif" class="linkArrow" width="8" height="14" /> </div> I am using a Transitional DTD in my example. Based on the everyone else's CSS examples, comments and answers I will make the final vote. I'd love to see more of these scenarios come up so that people have a library of "best practice" methods which they can find on SO. Good luck

    Read the article

  • Wordpress, PodCMS and Search

    - by Vian Esterhuizen
    Hey guys, I have a WordPress site for a client. He owns a video store, and I made a site for him to update the list of movies, usually just the "new this week" movies. The Pod has a field where you insert the release date. 2010-04-20 Then there is a Pod page/template combo that calls the movies with a certain release date like this: $date = pods_url_variable('last'); He then just creates a blank WP page with the slug 2010-04-20 So when you open that page, the Pod page/template reads that slug and renders a list of the appropriate movies. My problem: I need these to be searchable. Is this possible. I'm also open to suggestions on other ways to go about making this site work. I need it to be as simple as that. Uploads some movies and creates a new page. Then the rest is done automatically. Please and thank you guys

    Read the article

  • Sphinx search distributed index tuning

    - by Andriy Bohdan
    I'm deciding how to split 3 large sphinx indexes between 3 servers. Each of the 3 indexes is searched separately. What's more effective: to host each index on separate machine Example machine1 - index1 machine2 - index2 machine3 - index3 or to split each index into 3 parts and host each part of the same index on separate machine. Example machine1 - index1_chunk1, index2_chunk1, index3_chunk1 machine2 - index1_chunk2, index2_chunk2, index3_chunk2 machine3 - index1_chunk3, index2_chunk3, index3_chunk3 ?

    Read the article

  • Inverted index in a search engine

    - by Ayman
    Hello there, I'm trying to write some code to make a small application for searching text from files. Files should be crawled, and I need to put an inverted index to boost searches. My problem is that I kind of have ideas about how the parser would be, I'm willing to implement the AND, NOT, OR in the query. Whereas, I couldn't figure out how my index should be... I have never created an inverted index so if any body could suggest a feasable way to do it I would be very grateful... I do know in theory how it works but my problem is I absolutely have no idea to make happen in MySql I need to give keywords being indexed a weight too... Thank you so much.

    Read the article

  • multiline perl search and replace (one-liner)

    - by yaya3
    I want to perform the following vim substitution as a one-liner in the terminal with perl. I would prefer to allow for any occurences of white space and/or new lines, rather than explicitly catering for them as I am below. %s/blockDontForget">\n*\s*<p><span><a\(.*\)<\/span>/blockDontForget"><p><a\1/g I've tried this: perl -pi -e 's/blockDontForget"><p><span><a(.*)<\/span>/blockDontForget"><p><a$1/msg' I presume I am misinterpreting the flags. Where am I going wrong? Thanks. EDIT: The above example is to strip the spans out of the following html: <div class="block blockDontForget"> <p><span><a href="../../../foo/bar/x/x.html">Lorem Ipsum</a></span></p> </div>

    Read the article

  • C++ string array binary search

    - by Jose Vega
    string Haystack[] = { "Alabama", "Alaska", "American Samoa", "Arizona", "Arkansas", "California", "Colorado", "Connecticut", "Delaware", "District of Columbia", "Florida", "Georgia", "Guam", "Hawaii", "Idaho", "Illinois", "Indiana", "Iowa", "Kansas", "Kentucky", "Louisiana", "Maine", "Maryland", "Massachusetts", "Michigan", "Minnesota", "Mississippi", "Missouri", "Montana", "Nebraska", "Nevada", "New Hampshire", "New Jersey", "New Mexico", "New York", "North Carolina", "North Dakota", "Northern Mariana Islands", "Ohio", "Oklahoma", "Oregon", "Pennsylvania", "Puerto Rico", "Rhode Island", "South Carolina", "South Dakota", "Tennessee", "Texas", "US Virgin Islands", "Utah", "Vermont", "Virginia", "Washington", "West Virginia", "Wisconsin", "Wyoming"}; string Needle = "Virginia"; if(std::binary_search(Haystack, Haystack+56, Needle)) cout<<"Found"; If I also wanted to find the location of the needle in the string array, is there an "easy" way to find out?

    Read the article

  • Deletion procedure for a Binary Search Tree

    - by Metz
    Consider the deletion procedure on a BST, when the node to delete has two children. Let's say i always replace it with the node holding the minimum key in its right subtree. The question is: is this procedure commutative? That is, deleting x and then y has the same result than deleting first y and then x? I think the answer is no, but i can't find a counterexample, nor figure out any valid reasoning. EDIT: Maybe i've got to be clearer. Consider the transplant(node x, node y) procedure: it replace x with y (and its subtree). So, if i want to delete a node (say x) which has two children i replace it with the node holding the minimum key in its right subtree: y = minimum(x.right) transplant(y, y.right) // extracts the minimum (it doesn't have left child) y.right = x.right y.left = x.left transplant(x,y) The question was how to prove the procedure above is not commutative.

    Read the article

  • Search book by title, and author

    - by Swoosh
    I got a table with columns: author firstname, author lastname, and booktitle Multiple users are inserting in the database, through an import, and I'd like to avoid duplicates. So I'm trying to do something like this: I have a record in the db: First Name: "Isaac" Last Name: "Assimov" Title: "I, Robot" If the user tries to add it again, it would be basically a non-split-text (would not be split up into author firstname, author lastname, and booktitle) So it would basically look like this: "Isaac Asimov - I Robot" or "Asimov, Isaac - I Robot" or "I Robot by Isaac Asimov" You see where I am getting at? (I cannot force the user to split up all the books into into author firstname, author lastname, and booktitle, and I don't even like the idea to force the user, because it's not too user-friendly) What is the best way (in SQL) to compare all this possible bookdata scenarios to what I have in the database, not to add the same book twice. I was thinking about a possibility of suggesting the user: "is THIS the book you are trying to add?" (imagine a list instead of the THIS word, just like on stackoverflow - ask question - Related Questions. I was thinking about soundex and maybe even the like operators, but so far i didn't get the results i was hoping.

    Read the article

  • manipulating strings, search text

    - by alhambraeidos
    Hi all, I try explain my issue: note 1: I have only strings, not files, ONLY strings. I have a string like this (NOTE: I include line numbers for better explain) The line separator is \r\n (CRLF) string allText = 1 Lorem ipsum Lorem ipsum 2 == START 001partXXX.sql == 3 Lorem ipsum TEXT Lorem ipsum 4 == END 001partXXX.sql == 5 Lorem ipsum TEXT Lorem ipsum 6 == START 002partzzz.sql == 7 Lorem ipsum TEXT Lorem ipsum 8 == END 002partzzz.sql == I have contents strings like this: string contents1 = == START 001partXXX.sql == Lorem ipsum TEXT Lorem ipsum == END 001partXXX.sql == the other content string: string contents2 = == START 002partzzz.sql == Lorem ipsum TEXT Lorem ipsum == END 002partzzz.sql == Then, allText.IndexOf(contents1) != -1 allText.IndexOf(contents2) != -1 I need function thats receive 3 parameters: allText, Contents, and text to find in contents, and it returns the line number of Text To Find in AllText For example, input: allText, contents2, "TEXT" ouput = line number 7 Another sample, input: allText, contents1, "TEXT" ouput = line number 3 Another sample, input: allText, contents1, "TEXT NOT FOUND" ouput = line number -1 How can I implement this function ?? any help very useful for me, Thanks in advanced.

    Read the article

  • MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

    - by Matthew Talbert
    I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 51 52 53 54 55 56 57 58 59 60 61 62  | Next Page >