Search Results

Search found 28762 results on 1151 pages for 'go goo go'.

Page 551/1151 | < Previous Page | 547 548 549 550 551 552 553 554 555 556 557 558  | Next Page >

• I have a 21TB array but only 16TB is visible from Windows

  - by Relentim

  CONTROLLER Raid Controller: 3Ware 9650SE-24M8 Disks: 21 x 1TB RAID5 Stripe 64KB WINDOWS OS: Windows Server 2003 SP2 32x Disk: Dynamic 19557.44GB Volume: Capacity 15832.19GB I guess my array must have a 4KB block size which is limiting it to 16TB. I think I would have to switch to a 64KB block size to be able to see a maximum of 256TB. Or create another unit on my controller to go above 16TB of storage. Unfortunately I have already added over 16TB, ideally I would like to shrink the array and reclaim the 5 disks that aren't doing anything. I don't think this is possible. More likely, can I change the block size so 20TB becomes visible in windows?

  Read the article

• Windows 7 tasks don't switch when clicking window

  - by Jonathan Weinraub

  I got a peculiar problem with an enduser today. He says for the past month or so, if he has a window open (not maximised) and he clicks the window below it (also not maximised), it won't switch to it. For example, if he is in Lotus Notes, and wants to go back to Firefox, and he clicks the Firefox title bar, the tasks don't change focus/switch to it. This doesn't happen for applications. Usually it is with Firefox but if he's in Matlab and goes to PADS for example, they switch fine. If you close the apps, and reopen them, it'll work, but about 30 minutes later the weirdness then resumes. Any insight would be greatly appreciated. Thanks!

  Read the article

• Unidentified Window OnStartup

  - by CMP

  Every time I start up windows vista lately, I see a random floating window. It is a tiny little window with no title, and only the resize, maximize and restore buttons. I'd post an image, but I don't have reputation here yet. I can close it, and it does indeed go away, but I would love to figure out what it is and stop it from popping up at all. I used Autohotkey's window spy on it and all I learned is that it is a swing window, which doesn't help me out a whole lot. Is there a good way to identify which process it belongs to and figure out how to kill it?

  Read the article

• RHEL 6.5 and LDAP

  - by zuboje

  I am trying to connect our Active directory server to brand new RHEL 6.5 server. I want to authenticate users using AD credentials, but I want to restrict that only certain users can login, I don't want to allow anybody from AD to connect to it. I would like to use something like this: CN=linuxtest,OU=SecurityGroups,DC=mydomain,DC=local but I am not sure how would I setup OU and CN. I use sssd for authentication and my id_provider = ad. I wanted to use id_provider = ldap, but that did not work at all and RHEL customer service told me to setup this way. But I want to have a little bit more control who can do what. I know I can use this to restrict simple_allow_users = user1, user2, but I have 400+ users, I really don't want to go and type them all. Question is how would I setup OU or CN for my search?

  Read the article

• Selectively routing traffic via ethernet or wifi, with proper DNS (Mac OS X 10.6)

  - by Dan

  When I'm at work, I access various intranet pages as well as the wider Internet through ethernet. However, the company LAN blocks some ports (e.g. Google Calendar). I can get to those through WiFi. So, I gave the Airport priority, and then using route add, I set up selective routing: all intranet traffic goes through the ethernet and everything else via WiFi: sudo route add 10.0.0.0/8 <intranet gateway>. However, there are a number of intranet sites that have their own DNS; i.e., hr.company.com only resolves on the intranet. The only way that I can get the DNS to work properly is to add the internal DNS server to the Airport DNS listing, however I fear that when I go elsewhere and forget, this will break things. What's the right way to get the DNS to resolve using this setup?

  Read the article

• WSUS Updates - Best Practice

  - by What'sTheStoryWishBone

  We have an isolated enviornment of a few hundred servers in which we use WSUS to push updates too. We have thousands of updates which to manage and push to devices testing along the way to ensure the update will not break anything. What are the best practices that you all follow in your enteprise networks to ensure an update does not go out to all the machines that will break something? We currently have ours broken into customized groups for each type of machine. There is one "Test Group" which has one PC of each type which we apply updates to for error checking. Is this a similar procedure others follow or is their an easier safer way to manage the thousands of WSUS updates?

  Read the article

• Converting an Small Business Server to a Workstation

  - by noway

  I am planning to buy a Dell PowerEdge T110 Server and convert it to workstation similar to Dell PowerEdge Precision T1700. The reasoning behind is the cost, if I do it by myself, it costs two times cheaper. However, I wonder what might go wrong in this way? The things I have thought of are: Client OSes are not officially supported. There might be some driver problems. The chasis is designed to be a server case, so there are not many useful inputs in the front side of the case. The server boots slower than usual PCs. What might else be a problem?

  Read the article

• Saving Proxy Settings from different networks

  - by elcool

  I go to different clients and they all have their networks with different proxy settings. So I'm always having to change the proxy settings and saving the info in a notebook, and it becomes a pain after a while. So, any good way to save all those proxies and have them recognize the network I'm on and load up? Currently I maintain two: one in IE for clients, and none in Firefox for when I'm at home. And I think the last network I was on asked me to save the proxy and I think it went to system settings. But I don't know much about networking.

  Read the article

• How do I fully clear Firefox's cache of CSS and JS files?

  - by Mike Webb

  I work on a website at my work. The issue is that if I visit the site, which uses the cached versions of the CSS and JS files, and then upload an updated copy of a CSS/JS file, Firefox will still use the cached version. I can go to 'Tools-Clear Recent History' and clear the Cache of "Everything" and it still uses the cached version of the files. It will eventually updated and use the new files, but it can takes hours for this change to occur. So, how do I completely clear Firefox's cache of these files?

  Read the article

• Connecting via url to a server that is on the same network as me

  - by Axehead

  Good day, I'm having problems with the ftp server I've just set up. I've already managed to configure my modem and wireless router to open up port 21 and setup ftp in my server. But It seems that when I try to connect to it when I'm in the same network as the server via URL, (ftp://mydomain.com) it redirects me to the modem's web interface. But then when I try to connect to it outside the network using a different internet connection. It succeeds. It also succeeds when I'm in the same network and I go to ftp://192.168.., the server's local IP. Am I supposed to adjust something in the modem or router? Or is this a different problem altogether? BTW I'm using Windows Server 2008 r2 as my server's OS and using IIS for ftp.

  Read the article

• Putting shortcuts onto user's machines using AD

  - by Rod

  I just handled a small task, which I would like to automate through Active Directory. We’ve written a few Intranet applications which get used a lot here. Occasionally someone will have to go to the front desk and work on something there, while one of the receptionists are away. They’ll always call us to have us put a shortcut onto their desktop linking to these Intranet applications. It’s just a bit of a nuisance, and I’m sure that AD could be used to automate creating shortcuts on user’s desktops pointing to our Intranet applications. The only thing is, I don’t know how to do this, and being a small shop that we are, we don’t have a system administrator at this time. So, how do we automate the creation of desktop shortcuts to websites, using AD in a Windows 2003 Server environment?

  Read the article

• Redirect audio from laptop to desktop over LAN

  - by Ram Rachum

  I want to be able to play a song on my laptop and have it sound through my desktop's (infinitely better) speakers. If you're familiar with Input Director: I want something that is to audio what Input Director is to mouse/keyboard. I want something that automatically redirects all audio from the laptop to the desktop in real time, and I want that solution to require, like Input Director, minimum maintenance. Beyond the initial setup, I don't want to have to babysit the program that does this. I want something that launches automatically with Windows and just works, and also allows me to cancel it whenever I want. And also doesn't go crazy when the laptop is turned on in a different network where the desktop computer isn't available. Any suggestions for such a program? (I use Windows XP on both computers.)

  Read the article

• Windows Server 2003 - Give User Full Admin Privileges

  - by APShredder

  I am running Windows Server 2003. There are a couple of user accounts that I would like to promote to Administrator accounts. I've tried several ways to do so, but I am still relatively new to setting up a server. If anyone has any ideas on how to go about promoting these users, I thank you in advance. EDIT: I should probably mention that this a domain controller. I didn't realize that this changed the answer I was looking for. I apologize, like I said before I am new to the world of servers. EDIT #2: I've added the users to the Administrator group like most of the answer recommended, but the users don't seem to have admin rights yet. I think this might be because they are also in the Domain Users group, which I can't seem to be able to remove them from.

  Read the article

• Problem starting X in unbuntu 10.10

  - by xain

  Hi, I recently installed ubuntu 10.10 on my old toshiba a100 (where I've been running XP with no problems for ages). The installation went fine, I can log in with my user account, but after that the screen has only the wallpaper (and the mouse is enabled). Any hints on how to troubleshoot it ? These are the Xorg and the messages log files. Thanks When booted in safe graphics mode it worked just fine. Is there a way to set that configuration as the default so I don't have to go through those menus every time I boot ?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Backup folder on sometimes attached external usb harddrive

  - by ctrler

  My girlfriend no longer has space her laptops drive to store her photos. The drive she has now is 750GB, so to go to a bigger drive would be expensive, as there isn't many 1.5tb 2.5 inch 9.5mm hdd on the market (as of now, there is only one). Because of that, I am thinking of moving her pictures to a cheap external usb hdd. As of now, I'm automatically backing up her important folders (My Documents, Pictures, etc.) using Windows 7 default backup software to a network drive. My problem is that I don't know of a good solution to automatically backup a folder residing on an usb disk. The usb disk won't be attached to the computer all the time, so I can't just treat it as a normal backup folder. Sometimes the backup would run and the folder would not be there! Anyone knows any software or methodology to backup folders on external usb hard drives that are not always present? Thanks

  Read the article

• Most efficient RAID configuration with 6 disks?

  - by Bob King

  I have a hand-me-down server that I'm setting up at home and it's got 6 72Gb hard disks (as well as 2 18Gb drives that I'm using for the OS). What is the best way to configure those 6 drives? Should I RAID 5 or 6, or go with something simpler, like mirroring? I'm planning to use it to hold a source control repository, and possibly data for a development SQL server. The machine has a hardware raid controller. It is an old IBM server.

  Read the article

• 1080p HD TV + what is minimum spec pc required to stream HD movie files to it?

  - by rutherford

  I want to stream hi-def (non flash-based) movies from my future minimum spec pc to my network-ready HDTV. What I want to know is a) when streaming from a computer (local wifi network), is the computer's cpu/video/ram resources used to the same extent as it would be if playing back on the computers local screen? If not what are the differences? b) So with streaming hd content what is the minimum spec processor I should go for, if i) only one TV is acting as client ii) two TVs are simultaneous clients.

  Read the article

• Allow Domain Users to install software on their computers

  - by Christa

  How would I go about allowing a 'domain user' to install software on their computer. I have active directory and group policy in place. Is there a setting in group policy that would allow this? I don't really want to make the domain users domain admins as well. There is a way to do this by adding the user to their local admins group under computer management. I need this for about 50 users so that gets to be a long process with that many users. Server: Windows Server 2008 R2 Client Machines: Windows 7

  Read the article

• SSRS report font problem on deployed reports

  - by Cylindric

  I have created several reports for my SQL Server Reporting Services 2008 SP2 server, using Visual Studio 2008 on my machine. The reports objects all use Arial as their font, in various sizes and weights. When I test them in VS, all looks fine, and I can print them and export them okay. When I deploy them to the server though, they look fine on-screen and if exported to PDF, but when printed directly from the web viewer, the fonts seem to go 'missing' - all the characters are squashed together as if there was a slight negative character-offset.

  Read the article

• Cant Add Columns to a AD Task pad except for the top level of the domain

  - by Darktux

  We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

  Read the article

• How do I get Acrobat Pro X to close files without quitting?

  - by CyberSkull

  Adobe Acrobat Pro X doesn't seem to want to relinquish files after I close them. When working on some PDFs after I save and close them, I then go to move (not copy) them to the appropriate done folder on our server. Then I get a series of errors saying that Windows cannot move the file as Acrobat Pro X has it open. Looking at the Acrobat window, the file is not loaded. Is there a way to get Acrobat Pro X to close the file like normal (without quitting the program) and actually release the file to the OS?

  Read the article

• SQL Cluster install on Hyper V options

  - by Chris W

  I've been reading up on running a SQL Cluster in a Hyper V environment and there seems to be a couple of options: Install guest cluster on 2 VMs that are themselves part of a fail over cluster. Install SQL cluster on 2 VMs but the VMs themselves are not part of an underlying cluster. With option 1, it's little more complex as there's effectively two clusters in play but this adds some flexibility in the sense that I'm free to migrate the VMs between and physical blades in their cluster for physical maintenance without affecting the status of the SQL guest cluster that's running within them. With option 2, the set-up is a bit simpler as there's only 1 cluster in the mix but my VMs are anchored to the physical blades that they're set-up on (I'll ignore the fact I could manually move the VHDs for the purposes of this question). Are there any other factors that I should consider here when deciding which option to go for? I'm free to test out both options and probably will do but if any one has working experience of these set-ups and can offer some input that would be great.

  Read the article

• In-house Trusted Certificate

  - by MrEdmundo

  Hi there I'm a developer looking at introducing ClickOnce deployment for an internal .NET Winforms application that will be distributed via the corporate network. Now I would like to deploy this application under the full trust model however in order for that to happen I need to sign the software with a certificate. I can do that with a "test" certificate that has no information of the publisher etc, however that means an extra step will occur on the users workstation where they will have to confirm that the software is OK. So what I want to know is. is there a way I can get my IT Infrastructure guys to create me a an "internal" certificate from the domains Certificate Authority, or do I have to go and pay for a certificate from somebody like VeriSign? Thanks

  Read the article

• Multiple Java Apps on single Server

  - by kdssea

  What is the best way to host potentially dozens of fairly trivial Java web applications on a single machine? These will be for different clients, and so having them isolated from each other is important, so that if one goes down, they don't all go down. I realize Tomcat can handle multiple apps on its own, but having them all run in a single tomcat instance sounds a little scary to me. An instance of tomcat per app also seems silly, since these apps are likely to be fairly basic. Any thoughts?

  Read the article

< Previous Page | 547 548 549 550 551 552 553 554 555 556 557 558  | Next Page >