Search Results

Search found 2500 results on 100 pages for 'util'.

Page 57/100 | < Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >

  • How to use @PersistentCapable annotation in Scala 2.8

    - by Gero
    Hi, I'm switching from Scala 2.7.7 to Scala 2.8.0RC3 and now a few of my classes don't compile anymore. The problem is in the @PersistentCapable annotation: import javax.jdo.annotations._ import java.util.Date @PersistenceCapable{identityType=IdentityType.APPLICATION} class Counter(dt: Date, cName: String, vl: int) { <.. snip ..> } This code results in the following compilation errors: [ERROR] /Users/gero/prive/kiva/kivanotify-gae/src/main/scala/net/vermaas/kivanotify/model/LoanProcessed.scala:7: error: expected start of definition [INFO] @PersistenceCapable{val identityType = IdentityType.APPLICATION} I already tried a couple of variations, did some Googling but without luck. Any ideas on how I can use the @PersistentCapable annotation with Scala 2.8.0 RC3? Thanks, Gero

    Read the article

  • Prim's MST algorithm implementation with Java

    - by user1290164
    I'm trying to write a program that'll find the MST of a given undirected weighted graph with Kruskal's and Prim's algorithms. I've successfully implemented Kruskal's algorithm in the program, but I'm having trouble with Prim's. To be more precise, I can't figure out how to actually build the Prim function so that it'll iterate through all the vertices in the graph. I'm getting some IndexOutOfBoundsException errors during program execution. I'm not sure how much information is needed for others to get the idea of what I have done so far, but hopefully there won't be too much useless information. This is what I have so far: I have a Graph, Edge and a Vertex class. Vertex class mostly just an information storage that contains the name (number) of the vertex. Edge class can create a new Edge that has gets parameters (Vertex start, Vertex end, int edgeWeight). The class has methods to return the usual info like start vertex, end vertex and the weight. Graph class reads data from a text file and adds new Edges to an ArrayList. The text file also tells us how many vertecis the graph has, and that gets stored too. In the Graph class, I have a Prim() -method that's supposed to calculate the MST: public ArrayList<Edge> Prim(Graph G) { ArrayList<Edge> edges = G.graph; // Copies the ArrayList with all edges in it. ArrayList<Edge> MST = new ArrayList<Edge>(); Random rnd = new Random(); Vertex startingVertex = edges.get(rnd.nextInt(G.returnVertexCount())).returnStartingVertex(); // This is just to randomize the starting vertex. // This is supposed to be the main loop to find the MST, but this is probably horribly wrong.. while (MST.size() < returnVertexCount()) { Edge e = findClosestNeighbour(startingVertex); MST.add(e); visited.add(e.returnStartingVertex()); visited.add(e.returnEndingVertex()); edges.remove(e); } return MST; } The method findClosesNeighbour() looks like this: public Edge findClosestNeighbour(Vertex v) { ArrayList<Edge> neighbours = new ArrayList<Edge>(); ArrayList<Edge> edges = graph; for (int i = 0; i < edges.size() -1; ++i) { if (edges.get(i).endPoint() == s.returnVertexID() && !visited(edges.get(i).returnEndingVertex())) { neighbours.add(edges.get(i)); } } return neighbours.get(0); // This is the minimum weight edge in the list. } ArrayList<Vertex> visited and ArrayList<Edges> graph get constructed when creating a new graph. Visited() -method is simply a boolean check to see if ArrayList visited contains the Vertex we're thinking about moving to. I tested the findClosestNeighbour() independantly and it seemed to be working but if someone finds something wrong with it then that feedback is welcome also. Mainly though as I mentioned my problem is with actually building the main loop in the Prim() -method, and if there's any additional info needed I'm happy to provide it. Thank you. Edit: To clarify what my train of thought with the Prim() method is. What I want to do is first randomize the starting point in the graph. After that, I will find the closest neighbor to that starting point. Then we'll add the edge connecting those two points to the MST, and also add the vertices to the visited list for checking later, so that we won't form any loops in the graph. Here's the error that gets thrown: Exception in thread "main" java.lang.IndexOutOfBoundsException: Index: 0, Size: 0 at java.util.ArrayList.rangeCheck(Unknown Source) at java.util.ArrayList.get(Unknown Source) at Graph.findClosestNeighbour(graph.java:203) at Graph.Prim(graph.java:179) at MST.main(MST.java:49) Line 203: return neighbour.get(0); in findClosestNeighbour() Line 179: Edge e = findClosestNeighbour(startingVertex); in Prim()

    Read the article

  • Java: how to initialize int without assigning a value?

    - by HH
    $ javac InitInt.java InitInt.java:9: '[' expected right = new int; ^ InitInt.java:9: ']' expected right = new int; ^ InitInt.java:13: ';' expected } ^ InitInt.java:14: ';' expected public int getRight(){return right;} ^ InitInt.java:15: reached end of file while parsing } ^ 5 errors $ cat InitInt.java import java.util.*; import java.io.*; public class InitInt { private final int right; public static void main(String[] args) { // I don't want to assign any value. // just initialize it, how? right = new int; // later assiging a value } public int getRight(){return right;} }

    Read the article

  • Can someone explain me implicit parameters in Scala?

    - by Oscar Reyes
    And more specifically how does the BigInt works for convert int to BigInt? In the source code it reads: ... implicit def int2bigInt(i: Int): BigInt = apply(i) ... How is this code invoked? I can understand how this other sample: "Date literals" works. In. val christmas = 24 Dec 2010 Defined by: implicit def dateLiterals(date: Int) = new { import java.util.Date def Dec(year: Int) = new Date(year, 11, date) } When int get's passed the message Dec with an int as parameter, the system looks for another method that can handle the request, in this case Dec(year:Int) Q1. Am I right in my understanding of Date literals? Q2. How does it apply to BigInt? Thanks

    Read the article

  • Integrate openid4java to GWT Project

    - by Slyker
    Hi, I created an GWT project in eclipse. Now I tried to implement openId with using the openid4java library. I imported the .jar files via properties--java build path: openid4java-0.9.5.jar lib/*.jar In addition I copied the .jar files into the war/WEB-INF/lib directory. The problem at hand comes up when I call the authenticate() method. Then I get a: HTTP ERROR 500 Problem accessing /openid/openid. Reason: access denied (java.lang.RuntimePermission modifyThreadGroup)Caused by:java.security.AccessControlException: access denied (java.lang.RuntimePermission modifyThreadGroup) at java.security.AccessControlContext.checkPermission(Unknown Source) at java.security.AccessController.checkPermission(Unknown Source) at java.lang.SecurityManager.checkPermission(Unknown Source) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkPermission(DevAppServerFactory.java:166) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkAccess(DevAppServerFactory.java:191) at java.lang.ThreadGroup.checkAccess(Unknown Source) at java.lang.Thread.init(Unknown Source) at java.lang.Thread.<init>(Unknown Source) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ReferenceQueueThread.<init>(MultiThreadedHttpConnectionManager.java:1039) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.storeReferenceToConnection(MultiThreadedHttpConnectionManager.java:164) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.access$900(MultiThreadedHttpConnectionManager.java:64) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ConnectionPool.createConnection(MultiThreadedHttpConnectionManager.java:750) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.doGetConnection(MultiThreadedHttpConnectionManager.java:469) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.getConnectionWithTimeout(MultiThreadedHttpConnectionManager.java:394) at org.apache.commons.httpclient.HttpMethodDirector.executeMethod(HttpMethodDirector.java:152) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:396) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:324) at org.openid4java.util.HttpCache.head(HttpCache.java:296) at org.openid4java.discovery.yadis.YadisResolver.retrieveXrdsLocation(YadisResolver.java:360) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:229) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:221) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:179) at org.openid4java.discovery.Discovery.discover(Discovery.java:134) at org.openid4java.discovery.Discovery.discover(Discovery.java:114) at org.openid4java.consumer.ConsumerManager.discover(ConsumerManager.java:527) at auth.openid.server.OpenIDServlet.authenticate(OpenIDServlet.java:138) at auth.openid.server.OpenIDServlet.doGet(OpenIDServlet.java:101) at javax.servlet.http.HttpServlet.service(HttpServlet.java:693) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.headerComplete(HttpConnection.java:923) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:547) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:212) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) Here my servlet source: import com.google.gwt.user.client.rpc.RemoteService; import org.openid4java.OpenIDException; import org.openid4java.consumer.ConsumerException; import org.openid4java.consumer.ConsumerManager; import org.openid4java.consumer.VerificationResult; import org.openid4java.discovery.DiscoveryInformation; import org.openid4java.discovery.Identifier; import org.openid4java.message.AuthRequest; import org.openid4java.message.ParameterList; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.IOException; import java.text.MessageFormat; import java.util.List; public final class OpenIDServlet extends HttpServlet implements RemoteService { private final ConsumerManager manager; public OpenIDServlet() { try { manager = new ConsumerManager(); } catch (ConsumerException e) { throw new RuntimeException("Error creating consumer manager", e); } } ... private void authenticate(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { final String loginString = request.getParameter(nameParameter); try { // perform discovery on the user-supplied identifier List discoveries = manager.discover(loginString); // attempt to associate with the OpenID provider // and retrieve one service endpoint for authentication DiscoveryInformation discovered = manager.associate(discoveries); // obtain a AuthRequest message to be sent to the OpenID provider AuthRequest authReq = manager.authenticate(discovered, "openid", null); // redirect to OpenID for authentication response.sendRedirect(authReq.getDestinationUrl(true)); } catch (OpenIDException e) { throw new ServletException("Login string probably caused an error. loginString = " + loginString, e); } } My question now is: What could be my fault? Did I make any mistakes in importing the openid4java library? (which?) All other methods in the servlet which do not use the openid4java implementation work fine. Thanks, Andreas

    Read the article

  • CruiseControl .Net Plugin Vb.net Error

    - by Brian
    I am trying to make my own Labeller plugin for Cruise Control .Net 1.4.3. I have made a class based on another plug in example but I keep getting an error Class 'AssemblyVersionLabeller' must implement 'Function Generate(integrationResult As IIntegrationResult) As String' for interface 'ThoughtWorks.CruiseControl.Core.ILabeller' Here is my code : Imports Exortech.NetReflector Imports ThoughtWorks.CruiseControl.Core Imports ThoughtWorks.CruiseControl.Core.Util Namespace NetAssembly.CCNet.Label _ Public Class AssemblyVersionLabeller Implements ILabeller Public Sub Run(ByVal result As IIntegrationResult) result.Label = Generate(result) End Sub Public Function Generate(ByVal integrationResult As IIntegrationResult) As String Dim label As String = integrationResult.LastIntegration.Label Return label End Function <ReflectorProperty("prefix", Required:=False)> _ Public Prefix As String = String.Empty End Class End Namespace What am I doing wrong? What have I missed? Background Info: I am using VS2005. I cant use CrusieControl 1.4.4 RC2 (which has an Assembly Labeller) because my source control's plugin (SCM Anywhere) doesnt work with it.

    Read the article

  • Run java thread at specific times

    - by rmarimon
    I have a web application that synchronizes with a central database four times per hour. The process usually takes 2 minutes. I would like to run this process as a thread at X:55, X:10, X:25, and X:40 so that the users knows that at X:00, X:15, X:30, and X:45 they have a clean copy of the database. It is just about managing expectations. I have gone through the executor in java.util.concurrent but the scheduling is done with the scheduleAtFixedRate which I believe provides no guarantee about when this is actually run in terms of the hours. I could use a first delay to launch the Runnable so that the first one is close to the launch time and schedule for every 15 minutes but it seems that this would probably diverge in time. Is there an easier way to schedule the thread to run 5 minutes before every quarter hour?

    Read the article

  • Can someone explain me implicit conversions in Scala?

    - by Oscar Reyes
    And more specifically how does the BigInt works for convert int to BigInt? In the source code it reads: ... implicit def int2bigInt(i: Int): BigInt = apply(i) ... How is this code invoked? I can understand how this other sample: "Date literals" works. In. val christmas = 24 Dec 2010 Defined by: implicit def dateLiterals(date: Int) = new { import java.util.Date def Dec(year: Int) = new Date(year, 11, date) } When int get's passed the message Dec with an int as parameter, the system looks for another method that can handle the request, in this case Dec(year:Int) Q1. Am I right in my understanding of Date literals? Q2. How does it apply to BigInt? Thanks

    Read the article

  • Change a localized InfoPlist.strings using an Xcode target

    - by nevan
    Here's an obscure problem. I'm using an InfoPlist.strings to localize my app name. It's only got one value: CFBundleDisplayName = "Mon App". The strings file is localized (putting it in a directory for that localization). I've just made an extra target, where I change things like the non-localized app name (different Info.plists), and the icon. I'm also changing the Default.png using a run script build phase (copying different files depending on the app type I'm building). I've tried using the script to copy different versions of my InfoPlist.strings, but I couldn't make it work. Here's what I used: if($TARGET_NAME == "MonApp")then cp fr.lproj/MonApp_InfoPlist.strings fr.lproj/InfoPlist.strings endif I've seen a post suggesting wincent strings util for processing strings, but wanted to see if there's an easy way to do this. Any help greatly appreciated.

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Rotate a 2d matrix to the right

    - by adam
    I want a 2d matrix to rotate to the right, it compiles fine but when I try to the run it freezes. For example I want {{10,20,30},{40,50,60}} to rotate into {{40,10},{50,20},{60,30}} import java.util.*; public class Rotate{ public static int[][] rotate(int[][] m) { int [][] rotateM = new int[m[0].length][m.length]; for (int i= 0; i< m.length; i= i++){ for (int j= 0; j< m[0].length; j= j++){ rotateM[i][j] = m[j][m.length-i-1]; } } return rotateM; } public static void main(String[]args){ int[][]m = {{10,20,30}, {40,50,60}}; System.out.println(Arrays.toString(rotate(m))); } }

    Read the article

  • JSF RuntimeException: Cannot find FacesContext

    - by Sunny Mate
    When i write <h:outputText value="Login Name"/> tag in my jsp i am getting "Cannot find FacesContext" error , with out that tag my jsp working fine here is my JSP <%@ page language="java" import="java.util.*" pageEncoding="ISO-8859-1"%> <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN"> <html> <%@ taglib uri="http://java.sun.com/jsf/html" prefix="h" %> <%@ taglib uri="http://java.sun.com/jsf/core" prefix="f" %> <body> Login Name <input type="text" value=""/><br> **<h:outputText value="Login Name"/>** Password<input type="password" value=""/><br> <input type="submit" value="Login"> </body> </html>

    Read the article

  • c# Generic List

    - by user177883
    I m populating data for different entities into set of lists using generic lists as follows : List<Foo> foos .. List<Bar> bars .. I need to write these lists to a file, i do have a util method to get the values of properties etc. using reflection. What i want to do is: using a single method to write these into files such as: void writeToFile(a generic list) { //Which i will write to file here. } How can i do this? I want to be able to call : writeToFile(bars); writeToFile(foos);

    Read the article

  • Casting to generic type in Java doesn't raise ClassCastException?

    - by Kip
    I have come across a strange behavior of Java that seems like a bug. Is it? Casting an Object to a generic type (say, K) does not throw a ClassCastException even if the object is not an instance of K. Here is an example: import java.util.*; public final class Test { private static<K,V> void addToMap(Map<K,V> map, Object ... vals) { for(int i = 0; i < vals.length; i += 2) map.put((K)vals[i], (V)vals[i+1]); //Never throws ClassCastException! } public static void main(String[] args) { Map<String,Integer> m = new HashMap<String,Integer>(); addToMap(m, "hello", "world"); //No exception System.out.println(m.get("hello")); //Prints "world", which is NOT an Integer!! } }

    Read the article

  • code for TouchPad works, but not for DPAD ...please help me to fix this..

    - by Chandan
    package org.coe.twoD; import android.app.Activity; import android.content.Context; import android.graphics.Canvas; import android.graphics.Color; import android.graphics.Paint; //import android.graphics.Path; import android.graphics.Rect; //import android.graphics.RectF; import android.os.Bundle; //import android.util.Log; import android.util.Log; import android.view.KeyEvent; import android.view.MotionEvent; import android.view.View; import android.view.View.OnClickListener; public class TwoD extends Activity implements OnClickListener { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); View draw2d = findViewById(R.id.draw_button); draw2d.setOnClickListener(this); } public void onClick(View v) { if (R.id.draw_button == v.getId()) { setContentView(new draw2D(this)); } } public class draw2D extends View { private static final String TAG = "Sudoku"; private float width; // width of one tile private float height; // height of one tile private int selX; // X index of selection private int selY; // Y index of selection private final Rect selRect = new Rect(); public draw2D(Context context) { super(context); } @Override protected void onSizeChanged(int w, int h, int oldw, int oldh) { width = w / 9f; height = h / 9f; getRect(selX, selY, selRect); Log.d(TAG, "onSizeChanged: width " + width + ", height " + height); super.onSizeChanged(w, h, oldw, oldh); } @Override protected void onDraw(Canvas canvas) { // Draw the background... Paint background = new Paint(); background.setColor(getResources().getColor(R.color.background)); canvas.drawRect(0, 0, getWidth(), getHeight(), background); // Draw the board... // Define colors for the grid lines Paint dark = new Paint(); dark.setColor(getResources().getColor(R.color.dark)); Paint hilite = new Paint(); hilite.setColor(getResources().getColor(R.color.hilite)); Paint light = new Paint(); light.setColor(getResources().getColor(R.color.light)); // Draw the minor grid lines for (int i = 0; i < 9; i++) { canvas.drawLine(0, i * height, getWidth(), i * height, light); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), light); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } // Draw the major grid lines for (int i = 0; i < 9; i++) { if (i % 3 != 0) continue; canvas.drawLine(0, i * height, getWidth(), i * height, dark); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), dark); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } /* * dark.setColor(Color.MAGENTA); Path circle= new Path(); * circle.addCircle(150, 150, 100, Path.Direction.CW); * canvas.drawPath(circle, dark); * * * Path rect=new Path(); * * RectF rectf= new RectF(150,200,250,300); rect.addRect(rectf, * Path.Direction.CW); canvas.drawPath(rect, dark); * * * canvas.drawRect(0, 0,250, 250, dark); * * * canvas.drawText("Hello", 200,200, dark); */ Paint selected = new Paint(); selected.setColor(Color.GREEN); canvas.drawRect(selRect, selected); } /* * public boolean onTouchEvent(MotionEvent event){ * if(event.getAction()!=MotionEvent.ACTION_DOWN) return * super.onTouchEvent(event); * select((int)(event.getX()/width),(int)(event.getY()/height)); * * * return true; } */ private void select(int x, int y) { invalidate(selRect); selX = Math.min(Math.max(x, 0), 8); selY = Math.min(Math.max(y, 0), 8); getRect(selX, selY, selRect); invalidate(selRect); } @Override public boolean onKeyUp(int keyCode, KeyEvent event) { return super.onKeyUp(keyCode, event); } @Override public boolean onTouchEvent(MotionEvent event) { if (event.getAction() != MotionEvent.ACTION_DOWN) return super.onTouchEvent(event); select((int) (event.getX() / width), (int) (event.getY() / height)); // game.showKeypadOrError(selX, selY); Log.d(TAG, "onTouchEvent: x " + selX + ", y " + selY); return true; } @Override public boolean onKeyDown(int keyCode, KeyEvent event) { Log.d(TAG, "onKeyDown: keycode=" + keyCode + ", event=" + event); switch (keyCode) { case KeyEvent.KEYCODE_DPAD_UP: select(selX, selY - 1); break; case KeyEvent.KEYCODE_DPAD_DOWN: select(selX, selY + 1); break; case KeyEvent.KEYCODE_DPAD_LEFT: select(selX - 1, selY); break; case KeyEvent.KEYCODE_DPAD_RIGHT: select(selX + 1, selY); break; default: return super.onKeyDown(keyCode, event); } return true; } private void getRect(int x, int y, Rect rect) { rect.set((int) (x * width), (int) (y * height), (int) (x * width + width), (int) (y * height + height)); } } }

    Read the article

  • Type-safe, generic, empty Collections with static generics

    - by Droo
    I return empty collections vs. null whenever possible. I switch between two methods for doing so using java.util.Collections: return Collections.EMPTY_LIST; return Collections.emptyList(); where emptyList() is supposed to be type-safe. But I recently discovered: return Collections.<ComplexObject> emptyList(); return Collections.<ComplexObject> singletonList(new ComplexObject()); etc. I see this method in Eclipse Package Explorer: <clinit> () : void but I don't see how this is done in the source code (1.5). How is this magic tomfoolerie happening!!

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • infoWindow on MarkerClusterer

    - by vishwanath
    I need infoWindow to be opened instead of zooming in map, when clicking on the ClusterMarker. I am using Gmaps util library MarkerClusterer for creating cluster of markers. I tried changing following line in markerclusterer.js ClusterMarker_.prototype = new GOverlay(); with ClusterMarker_.prototype = new GMarker(); so that I can get the openInfoWindow() function in the clustermarker, but that didnt worked out. Got some error. If possible, Please suggest solution so that this can be done with MarkerClusterer. Or else any other library which will be able to do this. Any help will be appreciated.

    Read the article

  • What causes this retainAll exception?

    - by Joren
    java.lang.UnsupportedOperationException: This operation is not supported on Query Results at org.datanucleus.store.query.AbstractQueryResult.contains(AbstractQueryResult.java:250) at java.util.AbstractCollection.retainAll(AbstractCollection.java:369) at namespace.MyServlet.doGet(MyServlet.java:101) I'm attempting to take one list I retrieved from a datastore query, and keep only the results which are also in a list I retrieved from a list of keys. Both my lists are populated as expected, but I can't seem to user retainAll on either one of them. // List<Data> listOne = new ArrayList(query.execute(theQuery)); // DatastoreService ds = DatastoreServiceFactory.getDatastoreService(); // List<Data> listTwo = new ArrayList(ds.get(keys).values()); // listOne.retainAll(listTwo);

    Read the article

  • Java - Parsing a Date from a String

    - by Yatendra Goel
    I want to parse a java.util.Date from a String. I tried the following code but got unexpected output: Date getDate() { Date date = null; SimpleDateFormat sdf = new SimpleDateFormat("EEE MMM dd"); try { date = sdf.parse("Sat May 11"); } catch (ParseException ex) { Logger.getLogger(URLExtractor.class.getName()).log(Level.SEVERE, null, ex); return null; } return date; } When I run the above code, I got the following output: Mon May 11 00:00:00 IST 1970

    Read the article

  • Riddle: Spot the serious bug in this bubble sort implementation

    - by ripper234
    (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

    Read the article

  • Understanding the workings of equals and hashCode in a HashMap

    - by andandandand
    I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >