Search Results

Search found 25614 results on 1025 pages for 'content filter'.

Page 646/1025 | < Previous Page | 642 643 644 645 646 647 648 649 650 651 652 653  | Next Page >

  • How to use jQuery to generate 2 new associated objects in a nested form?

    - by mind.blank
    I have a model called Pair, which has_many :questions, and each Question has_one :answer. I've been following this railscast on creating nested forms, however I want to generate both a Question field and it's Answer field when clicking on an "Add Question" link. After following the railscast this is what I have: ..javascripts/common.js.coffee: window.remove_fields = (link)-> $(link).closest(".question_remove").remove() window.add_fields = (link, association, content)-> new_id = new Date().getTime() regexp = new RegExp("new_" + association, "g") $(link).before(content.replace(regexp, new_id)) application_helper.rb: def link_to_add_fields(name, f, association) new_object = f.object.class.reflect_on_association(association).klass.new fields = f.simple_fields_for(association, new_object, :child_index => "new_#{association}") do |builder| render(association.to_s.singularize + "_fields", :f => builder) end link_to_function(name, "window.add_fields(this, \"#{association}\", \"#{escape_javascript(fields)}\")", class: "btn btn-inverse") end views/pairs/_form.html.erb: <%= simple_form_for(@pair) do |f| %> <div class="row"> <div class="well span4"> <%= f.input :sys_heading, label: "System Heading", placeholder: "required", input_html: { class: "span4" } %> <%= f.input :heading, label: "User Heading", input_html: { class: "span4" } %> <%= f.input :instructions, as: :text, input_html: { class: "span4 input_text" } %> </div> </div> <%= f.simple_fields_for :questions do |builder| %> <%= render 'question_fields', f: builder %> <% end %> <%= link_to_add_fields "<i class='icon-plus icon-white'></i> Add Another Question".html_safe, f, :questions %> <%= f.button :submit, "Save Pair", class: "btn btn-success" %> <% end %> _question_fields.html.erb partial: <div class="question_remove"> <div class="row"> <div class="well span4"> <%= f.input :text, label: "Question", input_html: { class: "span4" }, placeholder: "your question...?" %> <%= f.simple_fields_for :answer do |builder| %> <%= render 'answer_fields', f: builder %> <% end %> </div> </div> </div> _answer_fields.html.erb partial: <%= f.input :text, label: "Answer", input_html: { class: "span4" }, placeholder: "your answer" %> <%= link_to_function "remove", "remove_fields(this)", class: "float-right" %> I'm especially confused by the reflect_on_association part, for example how does calling .new there create an association? I usually need to use .build Also for a has_one I use .build_answer rather than answers.build - so what does this mean for the jQuery part?

    Read the article

  • How to access the database when developing on a phone?

    - by Pentium10
    I am having trouble accessing the database while I am developing on the phone. Whenever I execute cd /data/data/com.mycompck/databases then if I try to run ls I get opendir failed, Permission denied Or whenever I type in: sqlite3 I get sqlite3: permission denied What I am doing wrong? Are there some applications that can help me getting a human view of content resolvers values and/or SQLite databases?

    Read the article

  • Google maps api v3: geocoding multiple addresses and infowindow

    - by user2536786
    I am trying to get infowindow for multiple addresses. Its creating markers but when I click on markers, infowindow is not popping up. Please help and see what could be wrong in this code. Rest all info is fine only issue is with infowindow not coming up. <!DOCTYPE html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=UTF-8" /> <title>Google Maps Multiple Markers</title> <script src="http://maps.google.com/maps/api/js?sensor=false" type="text/javascript"></script> </head> <body> <div id="map" style="height: 800px;"></div> <script type="text/javascript"> var locations = [ ['Bondi Beach', '850 Bay st 04 Toronto, Ont'], ['Coogee Beach', '932 Bay Street, Toronto, ON M5S 1B1'], ['Cronulla Beach', '61 Town Centre Court, Toronto, ON M1P'], ['Manly Beach', '832 Bay Street, Toronto, ON M5S 1B1'], ['Maroubra Beach', '606 New Toronto Street, Toronto, ON M8V 2E8'] ]; var map = new google.maps.Map(document.getElementById('map'), { zoom: 10, center: new google.maps.LatLng(43.253205,-80.480347), mapTypeId: google.maps.MapTypeId.ROADMAP }); var infowindow = new google.maps.InfoWindow(); var geocoder = new google.maps.Geocoder(); var marker, i; for (i = 0; i < locations.length; i++) { geocoder.geocode( { 'address': locations[i][1]}, function(results, status) { //alert(status); if (status == google.maps.GeocoderStatus.OK) { //alert(results[0].geometry.location); map.setCenter(results[0].geometry.location); marker = new google.maps.Marker({ position: results[0].geometry.location, map: map }); google.maps.event.addListener(marker, 'mouseover', function() { infowindow.open(marker, map);}); google.maps.event.addListener(marker, 'mouseout', function() { infowindow.close();}); } else { alert("some problem in geocode" + status); } }); } </script> </body> </html>

    Read the article

  • ipad saving excel sheet opened in uiwebview

    - by satyam
    I've few excel sheets and i want to distribut them along with ap. I want to create an application that open those excel sheets, allow user to modify the content and save the excel sheet as new file. For that purpose, I think I can open excel sheets in UIWebView that allows editing as well. But the trouble is, can I save edited Excel sheet in UIWebView back on to iPad? If Possible, how?

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • Fill all avaible space.

    - by Neir0
    Hi! I have a xaml code: <Grid> <WrapPanel> <TextBox ></TextBox> <Button Content="GetIt" /> </WrapPanel> </Grid> How i can to get all avaible space for textBox? i want to do something like that: |[__________][GetIt]|

    Read the article

  • Date based publishing ASP.NET MVC

    - by kayluhb
    I am building a custom CMS in ASP.NET MVC and one of the requirements is that the content has a start and end date that dictates whether or not the page appears on the site. What is the best approach to this? Should I run some sort of chron job to mark the status of the page according to its publish dates? Does anyone have any resources or advice on the matter?

    Read the article

  • Validation is not working

    - by Joby Kurian
    hi...I have one asp content page.Its contain many controls like dropdownlist,textbox etc.All controls are inside a div tag.I gave required field validator for all my drop down list.i have one SAVE button that reside inside another div tag.I gave SAVE button cause validation true.But my problem is that, the validator is not working and the page.Isvalid property is true.What is the problem with my code?

    Read the article

  • Limiting the Formatting Options in TinyMCE

    - by zjm1126
    this is my tinymce code: tinyMCE.init({ // General options mode : "textareas", theme : "advanced", //plugins : "safari,pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,inlinepopups,insertdatetime,preview,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,nonbreaking,xhtmlxtras,template", // Theme options theme_advanced_buttons1 : "bold,italic,underline", theme_advanced_toolbar_location : "top", theme_advanced_toolbar_align : "left", theme_advanced_statusbar_location : "bottom", theme_advanced_resizing : true, // Example content CSS (should be your site CSS) //content_css : "css/example.css", // Drop lists for link/image/media/template dialogs template_external_list_url : "js/template_list.js", external_link_list_url : "js/link_list.js", external_image_list_url : "js/image_list.js", media_external_list_url : "js/media_list.js", // Replace values for the template plugin template_replace_values : { username : "Some User", staffid : "991234" } }); thanks

    Read the article

  • ASP.NET MVC : how do I return 304 "Not Modified" status?

    - by THX-1138
    ASP.NET MVC 3.0, IIS 7, .NET 4 I have an action that returns data that seldom changes (almost static). Is there an easy way to: return 304 "Not Modified" from action; include "Last-Modified" time stamp in the response. I use return Content('my data'); for action result. Basically I want an easy way to do what is talked about in this article : http://weblogs.asp.net/jeff/archive/2009/07/01/304-your-images-from-a-database.aspx

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • Wordpress upload from localhost to server

    - by raspberry
    I uploaded my wordpress site from my Local host to a folder off my main domain (http://example.com/folder) using this tutorial http://www.webdesignerwall.com/tutorials/exporting-and-importing-wordpress/ (im working on a mac) Everything went ok - admin panel is fine homepage is fine etc - only any page apart from the homepage redirects to this (http://example.com/folder/pagename) except instead of showing the content from that page it shows the unstyled information from the index page of my main root (http://example.com/) What can I do to get this working? Thanks

    Read the article

< Previous Page | 642 643 644 645 646 647 648 649 650 651 652 653  | Next Page >