Search Results

Search found 20582 results on 824 pages for 'double array'.

Page 649/824 | < Previous Page | 645 646 647 648 649 650 651 652 653 654 655 656  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • $.(ajax) wrapper for Jquery - passing parameters to delegates

    - by gnomixa
    I use $.(ajax) function extensively in my app to call ASP.net web services. I would like to write a wrapper in order to centralize all the ajax calls. I found few simple solutions, but none address an issue of passing parameters to delegates, for example, if i have: $.ajax({ type: "POST", url: "http://localhost/TemplateWebService/TemplateWebService/Service.asmx/GetFoobar", data: jsonText, contentType: "application/json; charset=utf-8", dataType: "json", success: function(response) { var results = (typeof response.d) == 'string' ? eval('(' + response.d + ')') : response.d; OnSuccess(results, someOtherParam1, someOtherParam2); }, error: function(xhr, status, error) { OnError(); } }); The wrapper to this call would have to have the way to pass someOtherParam1, someOtherParam2 to the OnSuccess delegate...Aside from packing the variables into a generic array, I can't think of other solutions. How did you guys address this issue?

    Read the article

  • Problems with my slotgame

    - by Raiden2k
    I'm coding a slot game for learning. Here's the source code. My questions are below. unit Unit1; {$mode objfpc}{$H+} interface uses Classes, SysUtils, Windows, FileUtil, Forms, Controls, Graphics, Dialogs, StdCtrls, ExtCtrls, ComCtrls, Menus, ActnList, Spin, FileCtrl; type { TForm1 } TForm1 = class(TForm) FloatSpinEdit1: TFloatSpinEdit; Guthabenlb: TLabel; s4: TLabel; s5: TLabel; s6: TLabel; s7: TLabel; s8: TLabel; s9: TLabel; Timer3: TTimer; Winlb: TLabel; Loselb: TLabel; slotbn: TButton; s1: TLabel; s2: TLabel; s3: TLabel; Timer1: TTimer; Timer2: TTimer; procedure FormCreate(Sender: TObject); procedure slotbnClick(Sender: TObject); procedure Timer1Timer(Sender: TObject); procedure Timer2Timer(Sender: TObject); procedure Timer3Timer(Sender: TObject); private { private declarations } FRollen : array [0..2, 0..9] of String; public { public declarations } end; var Form1: TForm1; wins,loses : Integer; guthaben : Double = 10; implementation {$R *.lfm} { TForm1 } procedure TForm1.slotbnClick(Sender: TObject); begin Guthaben := Guthaben - 1.00; Guthabenlb.Caption := FloatToStr(guthaben) + (' €'); Timer1.Enabled := True; Timer2.Enabled := True; slotbn.Enabled := false; end; procedure TForm1.FormCreate(Sender: TObject); var i: integer; j: integer; n: integer; digits: TStringlist; begin Digits := TStringList.Create; try for i := low(FRollen) to high(FRollen) do begin for j := low(FRollen[i]) to high(FRollen[i]) do Digits.Add(IntToStr(j)); for j := low(FRollen[i]) to high(FRollen[i]) do begin n := Random(Digits.Count); FRollen[i, j] := Digits[n]; Digits.Delete(n); end; end finally Digits.Free; end; for i:=low(FRollen) to high(FRollen) do begin end; end; //==================================================================================================\\ // Drehen der Slots im Zufallsmodus //==================================================================================================// procedure TForm1.Timer1Timer(Sender: TObject); begin s1.Caption := IntToStr(Random(9)); s2.Caption := IntToStr(Random(9)); s3.Caption := IntToStr(Random(9)); s4.Caption := IntToStr(Random(9)); s5.Caption := IntToStr(Random(9)); s6.Caption := IntToStr(Random(9)); s7.Caption := IntToStr(Random(9)); s8.Caption := IntToStr(Random(9)); s9.Caption := IntToStr(Random(9)); end; //==================================================================================================// //===================================================================================================\\ // Gewonnen / Verloren abfrage //===================================================================================================// procedure TForm1.Timer2Timer(Sender: TObject); begin Timer1.Enabled := False; Timer2.Enabled := false; if (s1.Caption = s5.Caption) and (s1.Caption = s9.Caption) then begin Guthaben := Guthaben + 5.00; Inc(wins); end else if (s1.Caption = s4.Caption) and (s1.Caption = s7.Caption) then begin Guthaben := Guthaben + 5.00; Inc(wins); end else if (s2.Caption = s5.Caption) and (s2.Caption = s8.Caption) then begin Guthaben := Guthaben + 5.00; Inc(wins); end else if (s3.Caption = s6.Caption) and (s3.Caption = s9.Caption) then begin Guthaben := Guthaben + 5.00; Inc(wins); end else if (s3.Caption = s5.Caption) and (s3.Caption = s7.Caption) then begin Guthaben := Guthaben + 5.00; Inc(wins); end else Inc(loses); slotbn.Enabled := True; Loselb.Caption := 'Loses: ' + IntToStr(loses); Winlb.Caption := 'Wins: ' + IntTostr(Wins); end; procedure TForm1.Timer3Timer(Sender: TObject); begin if (guthaben = 0) or (guthaben < 0) then begin Timer3.Enabled := False; MessageBox(handle,'Du hast verloren!','Verlierer!',MB_OK); close(); end; end; //======================================================================================================\\ end. How can I replace the labels through icons 16 x 16 pixels? How can I adjust the winning sum according to the icons? (for example 3 crowns give you 40 € and 3 apples only 10 €) How can I adjust the winning sum with a sum for every round?

    Read the article

  • runtime loading of ValidateAntiForgeryToken Salt value

    - by p.campbell
    Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

    Read the article

  • Output to jTextArea in realtime

    - by Robert
    I have some code which takes a few minutes to process, it has to connect to the web for each string in a long array, each string is a url. I want to make it so that everytime it connects, it should refresh the jtextarea so that the user is not staring into a blank page that looks frozen for 20 min. or however long it takes. here is an example of something i tried and didnt work: try { ArrayList<String> myLinks = LinkParser.getmyLinksArray(jTextArea1.getText()); for (String s : myLinks) { jTextArea2.append(LinkChecker.checkFileStatus(s) + "\n"); } } catch (IOException ex) { JOptionPane.showMessageDialog(jTextArea1, "Parsing Error", "Parsing Error", JOptionPane.ERROR_MESSAGE); Logger.getLogger(MYView.class.getName()).log(Level.SEVERE, null, ex); }

    Read the article

  • (External) Java library for creating Tree structure ?

    - by suVasH.....
    I am planning to implement a tree structure where every node has two children and a parent along with various other node properties (and I'd want to do this in Java ) Now, the way to it probably is to create the node such that it links to other nodes ( linked list trick ), but I was wondering if there is any good external library to handle all this low level stuff. ( for eg. the ease of stl::vector vs array in C++ ). I've heard of JDots, but still since i haven't started (and haven't programmed a lot in Java), I'd rather hear out before I begin.

    Read the article

  • PHP anonymous functions scope question

    - by Dan
    Hi, I'm trying to sort an array of objects by a common property, however I cannot get my $property parameter to register in the inner function (I can use it in the outer one OK). The way I read the documentation, it sounded like the parameter would be available, have I misunderstood something? Here is what I have: public static function sortObjectsByProperty($objects, $property) { function compare_object($a, $b) { $a = $a->$property; $b = $b->$property; if ($a->$property == $b->$property) { return 0; } return ($a->$property > $b->$property) ? +1 : -1; } usort($objects, 'compare_object'); return $objects; } Any advice appreciated. Thanks.

    Read the article

  • how to get last inserted id - zend

    - by Lemon
    I'm trying to get latest inserted id from a table using this code: $id = $tbl->fetchAll (array('public=1'), 'id desc'); but it's always returning "1" any ideas? update: I've just discovered toArray();, which retrieves all the data from fetchAll. The problem is, I only need the ID. My current code looks like this: $rowsetArray = $id->toArray(); $rowCount = 1; foreach ($rowsetArray as $rowArray) { foreach ($rowArray as $column => $value) { if ($column="id") {$myid[$brr] = $value;} //echo"\n$myid[$brr]"; } ++$rowCount; ++$brr; } Obviously, I've got the if ($column="id") {$myid[$brr] = $value;} thing wrong. Can anyone point me in the right direction? An aternative would be to filter ID's from fetchAll. Is that possible?

    Read the article

  • Estimate serialization size of objects?

    - by Stefan K.
    In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

    Read the article

  • http_post_data basic authentication?

    - by kristian nissen
    I have a remote service that I need to access, according to the documentation it's restricted using basic authentication and all requests have to be posted (HTTP POST). The documentation contains this code example - VB script: Private Function SendRequest(ByVal Url, ByVal Username, ByVal Password, ByVal Request) Dim XmlHttp Set XmlHttp = CreateObject("MSXML2.XmlHttp") XmlHttp.Open "POST", Url, False, Username, Password XmlHttp.SetRequestHeader "Content-Type", "text/xml" XmlHttp.Send Request Set SendRequest = XmlHttp End Function how can I accomplish this in PHP? When I post data to the remote server it replies: 401 Unauthorized Access which is fine because I'm not posting my user/pass just the data. Bu when I add my user/pass as it's describe here: http://dk.php.net/manual/en/http.request.options.php like this: $res = http_post_data('https://example.com', $data, array( 'Content-Type: "text/xml"', 'httpauth' => base64_encode('user:pass'), 'httpauthtype' => HTTP_AUTH_BASIC ) ); the protocol is https - I get a runtime error in return (it's a .Net service). I have tried it without the base64_encode but with the same result.

    Read the article

  • How to GetGuiResources for all system processes?

    - by Krzysztof
    Hello, I need to measure all used GDI objects in a Windows xp system. I found a GetGuiResources(__in HANDLE hProcess, __in DWORD uiFlags) method (with the GR_GDIOBJECTS flag). I call it for the process which I get from the method GetCurrentProcess() defined in WinBase.h. I don't know how to call it for other system processes, which I get by System::Diagnostics::Process::GetProcesses(), because that function returns an array of Process pointers, and GetGuiResources takes a HANDLE. Does anybody know a solution for that? How can I transform Process pointer to a Handle or get HANDLEs for all running system processes? thanks for help in advance!

    Read the article

  • A controller problem using a base CRUD model

    - by rkj
    In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

    Read the article

  • Using Stored Procedures in SSIS

    - by dataintegration
    The SSIS Data Flow components: the source task and the destination task are the easiest way to transfer data in SSIS. Some data transactions do not fit this model, they are procedural tasks modeled as stored procedures. In this article we show how you can call stored procedures available in RSSBus ADO.NET Providers from SSIS. In this article we will use the CreateJob and the CreateBatch stored procedures available in RSSBus ADO.NET Provider for Salesforce, but the same steps can be used to call a stored procedure in any of our data providers. Step 1: Open Visual Studio and create a new Integration Services Project. Step 2: Add a new Data Flow Task to the Control Flow window. Step 3: Open the Data Flow Task and add a Script Component to the data flow pane. A dialog box will pop-up allowing you to select the Script Component Type: pick the source type as we will be outputting columns from our stored procedure. Step 4: Double click the Script Component to open the editor. Step 5: In the "Inputs and Outputs" settings, enter all the columns you want to output to the data flow. Ensure the correct data type has been set for each output. You can check the data type by selecting the output and then changing the "DataType" property from the property editor. In our example, we'll add the column JobID of type String. Step 6: Select the "Script" option in the left-hand pane and click the "Edit Script" button. This will open a new Visual Studio window with some boiler plate code in it. Step 7: In the CreateOutputRows() function you can add code that executes the stored procedures included with the Salesforce Component. In this example we will be using the CreateJob and CreateBatch stored procedures. You can find a list of the available stored procedures along with their inputs and outputs in the product help. //Configure the connection string to your credentials String connectionString = "Offline=False;user=myusername;password=mypassword;access token=mytoken;"; using (SalesforceConnection conn = new SalesforceConnection(connectionString)) { //Create the command to call the stored procedure CreateJob SalesforceCommand cmd = new SalesforceCommand("CreateJob", conn); cmd.CommandType = CommandType.StoredProcedure; cmd.Parameters.Add(new SalesforceParameter("ObjectName", "Contact")); cmd.Parameters.Add(new SalesforceParameter("Action", "insert")); //Execute CreateJob //CreateBatch requires JobID as input so we store this value for later SalesforceDataReader rdr = cmd.ExecuteReader(); String JobID = ""; while (rdr.Read()) { JobID = (String)rdr["JobID"]; } //Create the command for CreateBatch, for this example we are adding two new rows SalesforceCommand batCmd = new SalesforceCommand("CreateBatch", conn); batCmd.CommandType = CommandType.StoredProcedure; batCmd.Parameters.Add(new SalesforceParameter("JobID", JobID)); batCmd.Parameters.Add(new SalesforceParameter("Aggregate", "<Contact><Row><FirstName>Bill</FirstName>" + "<LastName>White</LastName></Row><Row><FirstName>Bob</FirstName><LastName>Black</LastName></Row></Contact>")); //Execute CreateBatch SalesforceDataReader batRdr = batCmd.ExecuteReader(); } Step 7b: If you had specified output columns earlier, you can now add data into them using the UserComponent Output0Buffer. For example, we had set an output column called JobID of type String so now we can set a value for it. We will modify the DataReader that contains the output of CreateJob like so:. while (rdr.Read()) { Output0Buffer.AddRow(); JobID = (String)rdr["JobID"]; Output0Buffer.JobID = JobID; } Step 8: Note: You will need to modify the connection string to include your credentials. Also ensure that the System.Data.RSSBus.Salesforce assembly is referenced and include the following using statements to the top of the class: using System.Data; using System.Data.RSSBus.Salesforce; Step 9: Once you are done editing your script, save it, and close the window. Click OK in the Script Transformation window to go back to the main pane. Step 10: If had any outputs from the Script Component you can use them in your data flow. For example we will use a Flat File Destination. Configure the Flat File Destination to output the results to a file, and you should see the JobId in the file. Step 11: Your project should be ready to run.

    Read the article

  • Fastest method for SQL Server inserts, updates, selects from C# ASP.Net 2.0+

    - by Ian
    Hi All, long time listener, first time caller. I use SPs and this isn't an SP vs code-behind "Build your SQL command" question. I'm looking for a high-throughput method for a backend app that handles many small transactions. I use SQLDataReader for most of the returns since forward only works in most cases for me. I've seen it done many ways, and used most of them myself. Methods that define and accept the stored procedure parameters as parameters themselves and build using cmd.Parameters.Add (with or without specifying the DB value type and/or length) Assembling your SP params and their values into an array or hashtable, then passing to a more abstract method that parses the collection and then runs cmd.Parameters.Add Classes that represent tables, initializing the class upon need, setting the public properties that represent the table fields, and calling methods like Save, Load, etc I'm sure there are others I've seen but can't think of at the moment as well. I'm open to all suggestions.

    Read the article

  • Zend Regex Route > Track the api version

    - by dskanth
    Hi, i am building a web service with zend and i am using modules to separate my api versions. Ex: "applications/modules/v1/controllers", "applications/modules/v2/controllers" have different set of actions and functionality. I have made "v1" as the default module in "application.ini" file: resources.modules = "" resources.frontController.defaultModule = "v1" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.moduleControllerDirectoryName = "controllers" I have written the following in my bootstrap file: $router = $front->getRouter(); $r1 = new Zend_Controller_Router_Route_Regex('api/v1/tags.xml', array('module' => 'v1', 'controller' => 'tags', 'action' => 'index')); $router->addRoute('route1', $r1); Suppose, if this is my url: http://localhost/api/v1/tags.xml then it belongs to version 1 (v1). But i dont want to write many routes like this one, so i want to know how can i track the version from the regex url and dynamically determine the api version to be used (1 or 2).

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Stackoverflow Flair Facebook app error

    - by emre
    Just to lewt you know, what happened when I allowed the app in FB Fatal error: Uncaught exception 'FacebookRestClientException' with message 'Param assoc_time must be a number' in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php:2878 Stack trace: #0 /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php(2544): FacebookRestClient-call_method('facebook.data.s...', Array) #1 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(188): FacebookRestClient-data_setAssociation('uid_so_uid2', '616867493', '5004213880486') #2 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(208): setSoUID('616867493', -1, Object(Facebook)) #3 /home/content/r/e/j/rejun2000/html/fb_so/index.php(26): updateProfileBox('616867493', -1, Object(Facebook)) #4 {main} thrown in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php on line 2878

    Read the article

  • WordPress Problem with enqueing a script

    - by casben79
    I am trying to enqueue a script from the functions.php file for a custom theme. here is the code I am using: wp_enqueue_script('innerfade','correct/path/to/innerfade.js', array('jquery'), '', false); I also tried to hardcode from the the functions file like so: ?> <script type='text/javascript' src="correct/path/to/innerfade.js"></script> <?php and both are outputting the following: correct/path/to/innerfade.js'?ver=2.9.2 so It doesnt seem to be a wp_enqueue_script problem What I cannot seem to figure is where the hell is the comma after the .js is coming from, it is causing a dead link hence not loading the script, anyone have any ideas??

    Read the article

  • Node.js mongoose: how to use the .in and .sort methods of a query?

    - by Chris
    Hi there, I'm trying to wrap my head around mongoose, but I'm having a hard time finding any kind of documentation for some of the more advanced query options, specifically the .in and .sort methods. What's the syntax for sorting, for example, a Person by age? db.model("Person").find().sort(???).all(function(people) { }); Then, let's say I want to find a Movie based on a genre, where a Movie can have many genres (in this case, an array of strings). Presumably, I'd use the .in function to accomplish that, but I'm not sure what the syntax would be. Or perhaps I don't have to use the .in method at all...? Either way, I'm lost. db.model("Movie").find().in(???).all(function(movies) { }); Anyone have any ideas? Or even better, a link to some comprehensive documentation? Thanks! Chris

    Read the article

  • .NET Regular expressions on bytes instead of chars

    - by brickner
    Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

    Read the article

  • A Visual Studio Release Grows in Brooklyn

    - by andrewbrust
    Yesterday, Microsoft held its flagship launch event for Office 2010 in Manhattan.  Today, the Redmond software company is holding a local launch event for Visual Studio (VS) 2010, in Brooklyn.  How come information workers get the 212 treatment and developers are relegated to 718? Well, here’s the thing: the Brooklyn Marriott is actually a great place for an event, but you need some intimate knowledge of New York City to know that.  NBC’s Studio 8H, where the Office launch was held yesterday (and from where SNL is broadcast) is a pretty small venue, but you’d need some inside knowledge to recognize that.  Likewise, while Office 2010 is a product whose value is apparent.  Appreciating VS 2010’s value takes a bit more savvy.  Setting aside its year-based designation, this release of VS, counting the old Visual Basic releases, is the 10th version of the product.  How can a developer audience get excited about an integrated development environment when it reaches double-digit version numbers?  Well, it can be tough.  Luckily, Microsoft sent Jay Schmelzer, a Group Program Manager from the Visual Studio team in Redmond, to come tell the Brooklyn audience why they should be excited. Turns out there’s a lot of reasons.  Support fro SharePoint development is a big one.  In previous versions of VS, that support has been anemic, at best.  Shortage of SharePoint developers is a huge issue in the industry, and this should help.  There’s also built in support for Windows Azure (Microsoft’s cloud platform) and, through a download, support for the forthcoming Windows Phone 7 platform.  ASP.NET MVC, a “close-to-the-metal” Web development option that does away with the Web Forms abstraction layer, has a first-class presence in VS.  So too does jQuery, the Open Source environment that makes JavaScript development a breeze.  The jQuery support is so good that Microsoft now contributes to that Open Source project and offers IntelliSense support for it in the code editor. Speaking of the VS code editor, it now supports multi-monitor setups, zoom-in, and block selection.  If you’re not a developer, this may sound confusing and minute.  I’ll just say that for people who are developers these are little things that really contribute to productivity, and that translates into lower development costs. The really cool demo, though, was around Visual Studio 2010’s new debugging features.  This stuff is hard to showcase, but I believe it’s truly breakthrough technology: imagine being able to step backwards in time to see what might have caused a bug.  Cool?  Now imagine being able to do that, even if you weren’t the tester and weren’t present while the testing was being done.  Then imagine being able to see a video screen capture of what the tester was doing with your app when the bug occurred.  VS 2010 allows all that.  This could be the demise of the IWOMM (“it works on my machine”) syndrome. After the keynote, I asked Schmelzer if any of Microsoft’s competitors have debugging tools that come close to VS 2010’s.  His answer was an earnest “we don’t think so.”  If that’s true, that’s a big deal, and a huge advantage for developer teams who adopt it.  It will make software development much cheaper and more efficient.  Kind of like holding a launch event at the Brooklyn Marriott instead of 30 Rock in Manhattan! VS 2010 (version 10) and Office 2010 (version 14) aren’t the only new product versions Microsoft is releasing right now.  There’s also SQL Server 2008 R2 (version 10.5), Exchange 2010 (version 8, I believe), SharePoint 2010 (version 4) and, of course, Windows 7.  With so many new versions at such levels of maturity, I think it’s fair to say Microsoft has reached middle-age.  How does a company stave off a potential mid-life crisis, especially when with young Turks like Google coming along and competing so fiercely?  Hard to say.  But if focusing on core value, including value that’s hard to play into a sexy demo, is part oft the answer, then Microsoft’s doing OK.  And if some new tricks, like Windows Phone 7, can gain some traction, that might round things out nicely. Are the legacy products old tricks, or are they revised classics?  I honestly don’t know, because it’s the market’s prerogative to pass that judgement.  I can say this though: based on today’s show, I think Microsoft’s been doing its homework.

    Read the article

  • How to restrict access to my web service?

    - by Hank
    I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

    Read the article

  • Creating a proper CMS thoughts

    - by dallasclark
    I'm just about to expand the functionality of our own CMS but was thinking of restructuring the database to make it simpler to add/edit data types and values. Currently, the CMS is quite flat - the CMS requires a field in the database for every type of stored value. The first option that comes to mind is simply a table which keeps the data types (ie: Address 1, Suburb, Email Address etc) and another table which holds values for each of these data types. Just like how Wordpress keeps values in the 'options' table, serialize would be used to store an array of values. The second option is how Drupal works, the CMS creates tables for every data type. Unlike Wordpress, this can be a bit of an overkill but really useful for SQL queries when ordering and grouping by a particular value. What's everyone's thoughts?

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • codeigniter: how to redirect after login to current controller (php_self in regular php)

    - by krike
    Well it's not really a problem but I check if the user exist and log them in and redirect to site/members_area, but I don't want to send the user to a specific page but i want to reload the current controller. So if I login in index/home I would like to be redirected at index/home, how should I proceed? in regular php I would put in the action to redirect to current page <?php echo $_SERVER['PHP_SELF']; ?> This is the code in the framework function validate_credentials() { $this->load->model('membership_model'); $query = $this->membership_model->validate(); if($query) // if the user's credentials validated... { $data = array( 'username' => $this->input->post('username'), 'is_logged_in' => true ); $this->session->set_userdata($data); redirect('site/members_area'); //<-- this line here should be dynamic } else // incorrect username or password { $this->index(); } }

    Read the article

< Previous Page | 645 646 647 648 649 650 651 652 653 654 655 656  | Next Page >