Search Results

Search found 20582 results on 824 pages for 'double array'.

Page 649/824 | < Previous Page | 645 646 647 648 649 650 651 652 653 654 655 656  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Help needed with Javascript Variable Scope / OOP and Call Back Functions

    - by gargantaun
    I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

    Read the article

  • Memory leak with preg_replace

    - by Silvio Donnini
    I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • CommunicationException in WCF

    - by user343159
    Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • codeigniter: how to redirect after login to current controller (php_self in regular php)

    - by krike
    Well it's not really a problem but I check if the user exist and log them in and redirect to site/members_area, but I don't want to send the user to a specific page but i want to reload the current controller. So if I login in index/home I would like to be redirected at index/home, how should I proceed? in regular php I would put in the action to redirect to current page <?php echo $_SERVER['PHP_SELF']; ?> This is the code in the framework function validate_credentials() { $this->load->model('membership_model'); $query = $this->membership_model->validate(); if($query) // if the user's credentials validated... { $data = array( 'username' => $this->input->post('username'), 'is_logged_in' => true ); $this->session->set_userdata($data); redirect('site/members_area'); //<-- this line here should be dynamic } else // incorrect username or password { $this->index(); } }

    Read the article

  • Binding Many-to-Many Core Data relationships in UI

    - by Kevin
    Basically my setup is this. I have a many-to-many relationship in Core Data where a student entity can have multiple courses, and a course entity can have multiple students. My problem is in trying to figure out how to bind this relationship to the UI in Interface Builder. I want to be able to add courses to a course array controller, then have those courses displayed in a popup menu in a NSTableView in the Edit Student window where you can add courses to a student. This is what I have so far: http://vimeo.com/10671726 It's probably easier to understand from the video. Thanks

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • Detecting a url using preg_match? without http:// in the string

    - by Stefan
    Hey there, I was wondering how I could check a string broken into an array against a preg_match to see if it started with www. I already have one that check for http://www. $stringToArray = explode(" ",$_POST['text']); foreach($stringToArray as $key=>$val){ $urlvalid = isValidURL($val); if($urlvalid){ $_SESSION["messages"][] = "NO URLS ALLOWED!"; header("Location: http://www.domain.com/post/id/".$_POST['postID']); exit(); } } Thanks! Stefan

    Read the article

  • property not updating in object when page is posted

    - by Jared
    Hi I have set a property in a constructor like so function __construct() { $this->count = count(@$_SESSION['filearray']); //count how many files in array } and using it in condition statements if($this->count > 10) //then do something but it appears the count isn't being updated when I use another method of injecting values into this 'filearray' until I refresh the page. am I doing something wrong? I thought that my constructor would detect a change had been made in the session and whenever I call $this-count I would get the current count value but it seems to be 1 step behind until I refresh the page. If this is all vague I can include my form page that has all the method calls, but this is the jist of my question, why is my property not updating and how do I fix it :) TIA

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • runtime loading of ValidateAntiForgeryToken Salt value

    - by p.campbell
    Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

    Read the article

  • A controller problem using a base CRUD model

    - by rkj
    In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

    Read the article

  • Loading XML file containing leading zeros with SSIS preserving the zeros

    - by Compudicted
    Visiting the MSDN SQL Server Integration Services Forum oftentimes I could see that people would pop up asking this question: “why I am not able to load an element from an XML file that contains zeros so the leading/trailing zeros would remain intact?”. I started to suspect that such a trivial and often-required operation perhaps is being misunderstood by the developer community. I would also like to add that the whole state of affairs surrounding the XML today is probably also going to be increasingly affected by a motion of people who dislike XML in general and many aspects of it as XSD and XSLT invoke a negative reaction at best. Nevertheless, XML is in wide use today and its importance as a bridge between diverse systems is ever increasing. Therefore, I deiced to write up an example of loading an arbitrary XML file that contains leading zeros in one of its elements using SSIS so the leading zeros would be preserved keeping in mind the goal on simplicity into a table in SQL Server database. To start off bring up your BIDS (running as admin) and add a new Data Flow Task (DFT). This DFT will serve as container to adding our XML processing elements (besides, the XML Source is not available anywhere else other than from within the DFT). Double-click your DFT and drag and drop the XMS Source component from the Tool Box’s Data Flow Sources. Now, let the fun begin! Being inspired by the upcoming Christmas I created a simple XML file with one set of data that contains an imaginary SSN number of Rudolph containing several leading zeros like 0000003. This file can be viewed here. To configure the XML Source of course it is quite intuitive to point it to our XML file, next what the XML source needs is either an embedded schema (XSD) or it can generate one for us. In lack of the one I opted to auto-generate it for me and I ended up with an XSD that looked like: <?xml version="1.0"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="XMasEvent"> <xs:complexType> <xs:sequence> <xs:element minOccurs="0" name="CaseInfo"> <xs:complexType> <xs:sequence> <xs:element minOccurs="0" name="ID" type="xs:unsignedByte" /> <xs:element minOccurs="0" name="CreatedDate" type="xs:unsignedInt" /> <xs:element minOccurs="0" name="LastName" type="xs:string" /> <xs:element minOccurs="0" name="FirstName" type="xs:string" /> <xs:element minOccurs="0" name="SSN" type="xs:unsignedByte" /> <!-- Becomes string -- > <xs:element minOccurs="0" name="DOB" type="xs:unsignedInt" /> <xs:element minOccurs="0" name="Event" type="xs:string" /> <xs:element minOccurs="0" name="ClosedDate" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema> As an aside on the XML file: if your XML file does not contain the outer node (<XMasEvent>) then you may end up in a situation where you see just one field in the output. Now please note that the SSN element’s data type was chosen to be of unsignedByte (and this is for a reason). The reason is stemming from the fact all our figures in the element are digits, this is good, but this is not exactly what we need, because if we will attempt to load the data with this XSD then we are going to either get errors on the destination or most typically lose the leading zeros. So the next intuitive choice is to change the data type to string. Besides, if a SSIS package was already created based on this XSD and the data type change was done thereafter, one should re-set the metadata by right-clicking the XML Source and choosing “Advanced Editor” in which there is a refresh button at the bottom left which will do the trick. So far so good, we are ready to load our XML file, well actually yes, and no, in my experience typically some data conversion may be required. So depending on your data destination you may need to tweak the data types targeted. Let’s add a Data Conversion Task to our DFT. Your package should look like: To make the story short I only will cover the SSN field, so in my data source the target SQL Table has it as nchar(10) and we chose string in our XSD (yes, this is a big difference), under such circumstances the SSIS will complain. So will go and manipulate on the data type of SSN by making it Unicode String (DT_WSTR), World String per se. The conversion should look like: The peek at the Metadata: We are almost there, now all we need is to configure the destination. For simplicity I chose SQL Server Destination. The mapping is a breeze, F5 and I am able to insert my data into SQL Server now! Checking the zeros – they are all intact!

    Read the article

  • $.(ajax) wrapper for Jquery - passing parameters to delegates

    - by gnomixa
    I use $.(ajax) function extensively in my app to call ASP.net web services. I would like to write a wrapper in order to centralize all the ajax calls. I found few simple solutions, but none address an issue of passing parameters to delegates, for example, if i have: $.ajax({ type: "POST", url: "http://localhost/TemplateWebService/TemplateWebService/Service.asmx/GetFoobar", data: jsonText, contentType: "application/json; charset=utf-8", dataType: "json", success: function(response) { var results = (typeof response.d) == 'string' ? eval('(' + response.d + ')') : response.d; OnSuccess(results, someOtherParam1, someOtherParam2); }, error: function(xhr, status, error) { OnError(); } }); The wrapper to this call would have to have the way to pass someOtherParam1, someOtherParam2 to the OnSuccess delegate...Aside from packing the variables into a generic array, I can't think of other solutions. How did you guys address this issue?

    Read the article

  • Node.js mongoose: how to use the .in and .sort methods of a query?

    - by Chris
    Hi there, I'm trying to wrap my head around mongoose, but I'm having a hard time finding any kind of documentation for some of the more advanced query options, specifically the .in and .sort methods. What's the syntax for sorting, for example, a Person by age? db.model("Person").find().sort(???).all(function(people) { }); Then, let's say I want to find a Movie based on a genre, where a Movie can have many genres (in this case, an array of strings). Presumably, I'd use the .in function to accomplish that, but I'm not sure what the syntax would be. Or perhaps I don't have to use the .in method at all...? Either way, I'm lost. db.model("Movie").find().in(???).all(function(movies) { }); Anyone have any ideas? Or even better, a link to some comprehensive documentation? Thanks! Chris

    Read the article

  • http_post_data basic authentication?

    - by kristian nissen
    I have a remote service that I need to access, according to the documentation it's restricted using basic authentication and all requests have to be posted (HTTP POST). The documentation contains this code example - VB script: Private Function SendRequest(ByVal Url, ByVal Username, ByVal Password, ByVal Request) Dim XmlHttp Set XmlHttp = CreateObject("MSXML2.XmlHttp") XmlHttp.Open "POST", Url, False, Username, Password XmlHttp.SetRequestHeader "Content-Type", "text/xml" XmlHttp.Send Request Set SendRequest = XmlHttp End Function how can I accomplish this in PHP? When I post data to the remote server it replies: 401 Unauthorized Access which is fine because I'm not posting my user/pass just the data. Bu when I add my user/pass as it's describe here: http://dk.php.net/manual/en/http.request.options.php like this: $res = http_post_data('https://example.com', $data, array( 'Content-Type: "text/xml"', 'httpauth' => base64_encode('user:pass'), 'httpauthtype' => HTTP_AUTH_BASIC ) ); the protocol is https - I get a runtime error in return (it's a .Net service). I have tried it without the base64_encode but with the same result.

    Read the article

  • Overwriting arguments object for a Javascript function

    - by Ian Storm Taylor
    If I have the following: // Clean input. $.each(arguments, function(index, value) { arguments[index] = value.replace(/[\W\s]+/g, '').toLowerCase(); }); Would that be a bad thing to do? I have no further use for the uncleaned arguments in the function, and it would be nice not to create a useless copy of arguments just to use them, but are there any negative effects to doing this? Ideally I would have done this, but I'm guessing this runs into problems since arguments isn't really an Array: arguments = $.map(arguments, function(value) { return value.replace(/[\W\s]+/g, '').toLowerCase(); }); Thanks for any input. EDIT: I've just realized that both of these are now inside their own functions, so the arguments object has changed. Any way to do this without creating an unnecessary variable?

    Read the article

  • how to get last inserted id - zend

    - by Lemon
    I'm trying to get latest inserted id from a table using this code: $id = $tbl->fetchAll (array('public=1'), 'id desc'); but it's always returning "1" any ideas? update: I've just discovered toArray();, which retrieves all the data from fetchAll. The problem is, I only need the ID. My current code looks like this: $rowsetArray = $id->toArray(); $rowCount = 1; foreach ($rowsetArray as $rowArray) { foreach ($rowArray as $column => $value) { if ($column="id") {$myid[$brr] = $value;} //echo"\n$myid[$brr]"; } ++$rowCount; ++$brr; } Obviously, I've got the if ($column="id") {$myid[$brr] = $value;} thing wrong. Can anyone point me in the right direction? An aternative would be to filter ID's from fetchAll. Is that possible?

    Read the article

  • Inserting multiple types into an SQLite database with Python

    - by mankoff
    I'm trying to create an SQLite 3 database from Python. I have a few types I'd like to insert into each record: A float, and then 3 groups of n floats, currently a tuple but could be an array or list.. I'm not well-enough versed in Python to understand all the differences. My problem is the INSERT statement. DAS = 12345 lats = (42,43,44,45) lons = (10,11,12,13) times = (1,2,3,4,5,6,7,8,9) import sqlite3 connection = sqlite3.connect("test.db") cursor = connection.cursor() cursor.execute( "create table foo(DAS LONG PRIMARY KEY,lats real(4),lons real(4), times real(9) )" ) I'm not sure what comes next. Something along the lines of: cmd = 'INSERT into foo values (?,?,?,?), ..." cursor.execute(cmd) How should I best build the SQL insert command given this data?

    Read the article

  • How to handle subclasses in JasperReports?

    - by gotch4
    I've two classes (A and B) that extend a base class BASE. I need to make a report that takes an array of such classes and the prints the fields of A or B. I tought of using conditional expressions, then casting to one or another (depending on a field value). But I can't cast, because I don't know how to refere to the current bean. To do this I am using a JRBeanCollectionDataSource filled with a List<BASE>. How do I cast every bean to A or B in a report (or subreport)? I tried: ((A)this) but it says basically that this contains the report instance, not the current bean and gives error.

    Read the article

  • Estimate serialization size of objects?

    - by Stefan K.
    In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

    Read the article

  • Grouping search results with thinking_sphinx plugin for rails

    - by Shagymoe
    I can use the following to group results, but it only returns one result per group. @results = Model.search params[:search_query], :group_by => 'created_at', :group_function => :day, :page => params[:page], :per_page => 50 So, if I display the results by day, I only get one result per day. <% @results.each_with_groupby do |result, group| %> <div class="group"><%= group %></div> <ul class="result"> <li><%= result.name %></li> </ul> <% end %> Do I have to parse the @results array and group them by date manually or am I missing something? Here is the line from the sphinx docs: http://sphinxsearch.com/docs/current.html#clustering "The final search result set then contains one best match per group."

    Read the article

< Previous Page | 645 646 647 648 649 650 651 652 653 654 655 656  | Next Page >