Search Results

Search found 21054 results on 843 pages for 'void'.

Page 835/843 | < Previous Page | 831 832 833 834 835 836 837 838 839 840 841 842  | Next Page >

  • Difference between Factory Method and Abstract Factory design patterns using C#.Net

    - by nijhawan.saurabh
    First of all I'll just put both these patterns in context and describe their intent as in the GOF book: Factory Method: Define an interface for creating an object, but let subclasses decide which class to instantiate. Factory Method lets a class defer instantiation to subclasses.   Abstract Factory: Provide an interface for creating families of related or dependent objects without specifying their concrete classes.   Points to note:   Abstract factory pattern adds a layer of abstraction to the factory method pattern. The type of factory is not known to the client at compile time, this information is passed to the client at runtime (How it is passed is again dependent on the system, you may store this information in configuration files and the client can read it on execution). While implementing Abstract factory pattern, the factory classes can have multiple factory methods. In Abstract factory, a factory is capable of creating more than one type of product (Simpilar products are grouped together in a factory)   Sample implementation of factory method pattern   Let's see the class diagram first:                   ProductFactory.cs // ----------------------------------------------------------------------- // <copyright file="ProductFactory.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public abstract class ProductFactory     {         /// <summary>         /// </summary>         /// <returns>         /// </returns>         public abstract Product CreateProductInstance();     } }     ProductAFactory.cs // ----------------------------------------------------------------------- // <copyright file="ProductAFactory.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public class ProductAFactory:ProductFactory     {         public override Product CreateProductInstance()         {             return new ProductA();         }     } }         // ----------------------------------------------------------------------- // <copyright file="ProductBFactory.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public class ProductBFactory:ProductFactory     {         public override Product CreateProductInstance()         {             return new ProductB();           }     } }     // ----------------------------------------------------------------------- // <copyright file="Product.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public abstract class Product     {         public abstract string Name { get; set; }     } }     // ----------------------------------------------------------------------- // <copyright file="ProductA.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public class ProductA:Product     {         public ProductA()         {               Name = "ProductA";         }           public override string Name { get; set; }     } }       // ----------------------------------------------------------------------- // <copyright file="ProductB.cs" company=""> // TODO: Update copyright text. // </copyright> // -----------------------------------------------------------------------   namespace FactoryMethod {     using System;     using System.Collections.Generic;     using System.Linq;     using System.Text;       /// <summary>     /// TODO: Update summary.     /// </summary>     public class ProductB:Product     {          public ProductB()         {               Name = "ProductA";         }         public override string Name { get; set; }     } }     Program.cs using System; using System.Collections.Generic; using System.Linq; using System.Text;   namespace FactoryMethod {     class Program     {         static void Main(string[] args)         {             ProductFactory pf = new ProductAFactory();               Product product = pf.CreateProductInstance();             Console.WriteLine(product.Name);         }     } }       Normal 0 false false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    Read the article

  • spring web application context is not loaded from jar file in WEB-INF/lib when running tomcat in eclipse

    - by Remy J
    I am experimenting with spring, maven, and eclipse but stumbling on a weird issue. I am running Eclipse Helios SR1 with the STS (Spring tools suite) plugin which includes the Maven plugin also. What i want to achieve is a spring mvc webapp which uses an application context loaded from a local application context xml file, but also from other application contexts in jar files dependencies included in WEB-INF/lib. What i'd ultimately like to do is have my persistence layer separated in its own jar file but containing its own spring context files with persistence specific configuration (e.g a jpa entityManagerFactory for example). So to experiment with loading resources from jar dependencies, i created a simple maven project from eclipse, which defines an applicationContext.xml file in src/main/resources Inside, i define a bean <bean id="mybean" class="org.test.MyClass" /> and create the class in the org.test package I run mvn-install from eclipse, which generates me a jar file containing my class and the applicationContext.xml file: testproj.jar |_META-INF |_org |_test |_MyClass.class |_applicationContext.xml I then create a spring mvc project from the Spring template projects provided by STS. I have configured an instance of Tomcat 7.0.8 , and also an instance of springSource tc Server within eclipse. Deploying the newly created project on both servers works without problem. I then add my previous project as a maven dependency of the mvc project. the jar file is correctly added in the Maven Dependencies of the project. In the web.xml that is generated, i now want to load the applicationContext.xml from the jar file as well as the existing one generated for the project. My web.xml now looks like this: org.springframework.web.context.ContextLoaderListener <!-- Processes application requests --> <servlet> <servlet-name>appServlet</servlet-name> <servlet-class>org.springframework.web.servlet.DispatcherServlet</servlet-class> <init-param> <param-name>contextConfigLocation</param-name> <param-value> classpath*:applicationContext.xml, /WEB-INF/spring/appServlet/servlet-context.xml </param-value> </init-param> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>appServlet</servlet-name> <url-pattern>/</url-pattern> </servlet-mapping> Also, in my servlet-context.xml, i have the following: <context:component-scan base-package="org.test" /> <context:component-scan base-package="org.remy.mvc" /> to load classes from the jar spring context (org.test) and to load controllers from the mvc app context. I also change one of my controllers in org.remy.mvc to autowire MyClass to verify that loading the context has worked as intended. public class MyController { @Autowired private MyClass myClass; public void setMyClass(MyClass myClass) { this.myClass = myClass; } public MyClass getMyClass() { return myClass; } [...] } Now this is the weird bit: If i deploy the spring mvc web on my tomcat instance inside eclipse (run on server...) I get the following error : org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping#0': Initialization of bean failed; nested exception is java.lang.NoClassDefFoundError: org/test/MyClass at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:527) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:442) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:458) at org.springframework.web.servlet.FrameworkServlet.initWebApplicationContext(FrameworkServlet.java:339) at org.springframework.web.servlet.FrameworkServlet.initServletBean(FrameworkServlet.java:306) at org.springframework.web.servlet.HttpServletBean.init(HttpServletBean.java:127) at javax.servlet.GenericServlet.init(GenericServlet.java:160) at org.apache.catalina.core.StandardWrapper.initServlet(StandardWrapper.java:1133) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1087) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:996) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:4834) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5155) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5150) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:885) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:907) at java.lang.Thread.run(Thread.java:619) Caused by: java.lang.NoClassDefFoundError: org/test/MyClass at java.lang.Class.getDeclaredMethods0(Native Method) at java.lang.Class.privateGetDeclaredMethods(Class.java:2427) at java.lang.Class.getDeclaredMethods(Class.java:1791) at org.springframework.util.ReflectionUtils.doWithMethods(ReflectionUtils.java:446) at org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping.determineUrlsForHandlerMethods(DefaultAnnotationHandlerMapping.java:172) at org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping.determineUrlsForHandler(DefaultAnnotationHandlerMapping.java:118) at org.springframework.web.servlet.handler.AbstractDetectingUrlHandlerMapping.detectHandlers(AbstractDetectingUrlHandlerMapping.java:79) at org.springframework.web.servlet.handler.AbstractDetectingUrlHandlerMapping.initApplicationContext(AbstractDetectingUrlHandlerMapping.java:58) at org.springframework.context.support.ApplicationObjectSupport.initApplicationContext(ApplicationObjectSupport.java:119) at org.springframework.web.context.support.WebApplicationObjectSupport.initApplicationContext(WebApplicationObjectSupport.java:72) at org.springframework.context.support.ApplicationObjectSupport.setApplicationContext(ApplicationObjectSupport.java:73) at org.springframework.context.support.ApplicationContextAwareProcessor.invokeAwareInterfaces(ApplicationContextAwareProcessor.java:106) at org.springframework.context.support.ApplicationContextAwareProcessor.postProcessBeforeInitialization(ApplicationContextAwareProcessor.java:85) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyBeanPostProcessorsBeforeInitialization(AbstractAutowireCapableBeanFactory.java:394) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1413) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:519) ... 25 more 20-Feb-2011 10:54:53 org.apache.catalina.core.ApplicationContext log SEVERE: StandardWrapper.Throwable org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.DefaultAnnotationHandlerMapping#0': Initialization of bean failed; nested exception is java.lang.NoClassDefFoundError: org/test/MyClass If i build the war file (using maven "install" goal), and then deploy that war file in the webapps directory of a standalone tomcat server (7.0.8 as well) it WORKS :-( What am i missing ? Thanks for the help.

    Read the article

  • Integrate openid4java to GWT Project

    - by Slyker
    Hi, I created an GWT project in eclipse. Now I tried to implement openId with using the openid4java library. I imported the .jar files via properties--java build path: openid4java-0.9.5.jar lib/*.jar In addition I copied the .jar files into the war/WEB-INF/lib directory. The problem at hand comes up when I call the authenticate() method. Then I get a: HTTP ERROR 500 Problem accessing /openid/openid. Reason: access denied (java.lang.RuntimePermission modifyThreadGroup)Caused by:java.security.AccessControlException: access denied (java.lang.RuntimePermission modifyThreadGroup) at java.security.AccessControlContext.checkPermission(Unknown Source) at java.security.AccessController.checkPermission(Unknown Source) at java.lang.SecurityManager.checkPermission(Unknown Source) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkPermission(DevAppServerFactory.java:166) at com.google.appengine.tools.development.DevAppServerFactory$CustomSecurityManager.checkAccess(DevAppServerFactory.java:191) at java.lang.ThreadGroup.checkAccess(Unknown Source) at java.lang.Thread.init(Unknown Source) at java.lang.Thread.<init>(Unknown Source) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ReferenceQueueThread.<init>(MultiThreadedHttpConnectionManager.java:1039) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.storeReferenceToConnection(MultiThreadedHttpConnectionManager.java:164) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.access$900(MultiThreadedHttpConnectionManager.java:64) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager$ConnectionPool.createConnection(MultiThreadedHttpConnectionManager.java:750) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.doGetConnection(MultiThreadedHttpConnectionManager.java:469) at org.apache.commons.httpclient.MultiThreadedHttpConnectionManager.getConnectionWithTimeout(MultiThreadedHttpConnectionManager.java:394) at org.apache.commons.httpclient.HttpMethodDirector.executeMethod(HttpMethodDirector.java:152) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:396) at org.apache.commons.httpclient.HttpClient.executeMethod(HttpClient.java:324) at org.openid4java.util.HttpCache.head(HttpCache.java:296) at org.openid4java.discovery.yadis.YadisResolver.retrieveXrdsLocation(YadisResolver.java:360) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:229) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:221) at org.openid4java.discovery.yadis.YadisResolver.discover(YadisResolver.java:179) at org.openid4java.discovery.Discovery.discover(Discovery.java:134) at org.openid4java.discovery.Discovery.discover(Discovery.java:114) at org.openid4java.consumer.ConsumerManager.discover(ConsumerManager.java:527) at auth.openid.server.OpenIDServlet.authenticate(OpenIDServlet.java:138) at auth.openid.server.OpenIDServlet.doGet(OpenIDServlet.java:101) at javax.servlet.http.HttpServlet.service(HttpServlet.java:693) at javax.servlet.http.HttpServlet.service(HttpServlet.java:806) at org.mortbay.jetty.servlet.ServletHolder.handle(ServletHolder.java:511) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1166) at com.google.appengine.api.blobstore.dev.ServeBlobFilter.doFilter(ServeBlobFilter.java:51) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.apphosting.utils.servlet.TransactionCleanupFilter.doFilter(TransactionCleanupFilter.java:43) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at com.google.appengine.tools.development.StaticFileFilter.doFilter(StaticFileFilter.java:122) at org.mortbay.jetty.servlet.ServletHandler$CachedChain.doFilter(ServletHandler.java:1157) at org.mortbay.jetty.servlet.ServletHandler.handle(ServletHandler.java:388) at org.mortbay.jetty.security.SecurityHandler.handle(SecurityHandler.java:216) at org.mortbay.jetty.servlet.SessionHandler.handle(SessionHandler.java:182) at org.mortbay.jetty.handler.ContextHandler.handle(ContextHandler.java:765) at org.mortbay.jetty.webapp.WebAppContext.handle(WebAppContext.java:418) at com.google.apphosting.utils.jetty.DevAppEngineWebAppContext.handle(DevAppEngineWebAppContext.java:70) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at com.google.appengine.tools.development.JettyContainerService$ApiProxyHandler.handle(JettyContainerService.java:349) at org.mortbay.jetty.handler.HandlerWrapper.handle(HandlerWrapper.java:152) at org.mortbay.jetty.Server.handle(Server.java:326) at org.mortbay.jetty.HttpConnection.handleRequest(HttpConnection.java:542) at org.mortbay.jetty.HttpConnection$RequestHandler.headerComplete(HttpConnection.java:923) at org.mortbay.jetty.HttpParser.parseNext(HttpParser.java:547) at org.mortbay.jetty.HttpParser.parseAvailable(HttpParser.java:212) at org.mortbay.jetty.HttpConnection.handle(HttpConnection.java:404) at org.mortbay.io.nio.SelectChannelEndPoint.run(SelectChannelEndPoint.java:409) at org.mortbay.thread.QueuedThreadPool$PoolThread.run(QueuedThreadPool.java:582) Here my servlet source: import com.google.gwt.user.client.rpc.RemoteService; import org.openid4java.OpenIDException; import org.openid4java.consumer.ConsumerException; import org.openid4java.consumer.ConsumerManager; import org.openid4java.consumer.VerificationResult; import org.openid4java.discovery.DiscoveryInformation; import org.openid4java.discovery.Identifier; import org.openid4java.message.AuthRequest; import org.openid4java.message.ParameterList; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.IOException; import java.text.MessageFormat; import java.util.List; public final class OpenIDServlet extends HttpServlet implements RemoteService { private final ConsumerManager manager; public OpenIDServlet() { try { manager = new ConsumerManager(); } catch (ConsumerException e) { throw new RuntimeException("Error creating consumer manager", e); } } ... private void authenticate(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { final String loginString = request.getParameter(nameParameter); try { // perform discovery on the user-supplied identifier List discoveries = manager.discover(loginString); // attempt to associate with the OpenID provider // and retrieve one service endpoint for authentication DiscoveryInformation discovered = manager.associate(discoveries); // obtain a AuthRequest message to be sent to the OpenID provider AuthRequest authReq = manager.authenticate(discovered, "openid", null); // redirect to OpenID for authentication response.sendRedirect(authReq.getDestinationUrl(true)); } catch (OpenIDException e) { throw new ServletException("Login string probably caused an error. loginString = " + loginString, e); } } My question now is: What could be my fault? Did I make any mistakes in importing the openid4java library? (which?) All other methods in the servlet which do not use the openid4java implementation work fine. Thanks, Andreas

    Read the article

  • Design pattern for cost calculator app?

    - by Anders Svensson
    Hi, I have a problem that I’ve tried to get help for before, but I wasn’t able to solve it then, so I’m trying to simplify the problem now to see if I can get some more concrete help with this because it is driving me crazy… Basically, I have a working (more complex) version of this application, which is a project cost calculator. But because I am at the same time trying to learn to design my applications better, I would like some input on how I could improve this design. Basically the main thing I want is input on the conditionals that (here) appear repeated in two places. The suggestions I got before was to use the strategy pattern or factory pattern. I also know about the Martin Fowler book with the suggestion to Refactor conditional with polymorphism. I understand that principle in his simpler example. But how can I do either of these things here (if any would be suitable)? The way I see it, the calculation is dependent on a couple of conditions: 1. What kind of service is it, writing or analysis? 2. Is the project small, medium or large? (Please note that there may be other parameters as well, equally different, such as “are the products new or previously existing?” So such parameters should be possible to add, but I tried to keep the example simple with only two parameters to be able to get concrete help) So refactoring with polymorphism would imply creating a number of subclasses, which I already have for the first condition (type of service), and should I really create more subclasses for the second condition as well (size)? What would that become, AnalysisSmall, AnalysisMedium, AnalysisLarge, WritingSmall, etc…??? No, I know that’s not good, I just don’t see how to work with that pattern anyway else? I see the same problem basically for the suggestions of using the strategy pattern (and the factory pattern as I see it would just be a helper to achieve the polymorphism above). So please, if anyone has concrete suggestions as to how to design these classes the best way I would be really grateful! Please also consider whether I have chosen the objects correctly too, or if they need to be redesigned. (Responses like "you should consider the factory pattern" will obviously not be helpful... I've already been down that road and I'm stumped at precisely how in this case) Regards, Anders The code (very simplified, don’t mind the fact that I’m using strings instead of enums, not using a config file for data etc, that will be done as necessary in the real application once I get the hang of these design problems): public abstract class Service { protected Dictionary<string, int> _hours; protected const int SMALL = 2; protected const int MEDIUM = 8; public int NumberOfProducts { get; set; } public abstract int GetHours(); } public class Writing : Service { public Writing(int numberOfProducts) { NumberOfProducts = numberOfProducts; _hours = new Dictionary<string, int> { { "small", 125 }, { "medium", 100 }, { "large", 60 } }; } public override int GetHours() { if (NumberOfProducts <= SMALL) return _hours["small"] * NumberOfProducts; if (NumberOfProducts <= MEDIUM) return (_hours["small"] * SMALL) + (_hours["medium"] * (NumberOfProducts - SMALL)); return (_hours["small"] * SMALL) + (_hours["medium"] * (MEDIUM - SMALL)) + (_hours["large"] * (NumberOfProducts - MEDIUM)); } } public class Analysis : Service { public Analysis(int numberOfProducts) { NumberOfProducts = numberOfProducts; _hours = new Dictionary<string, int> { { "small", 56 }, { "medium", 104 }, { "large", 200 } }; } public override int GetHours() { if (NumberOfProducts <= SMALL) return _hours["small"]; if (NumberOfProducts <= MEDIUM) return _hours["medium"]; return _hours["large"]; } } public partial class Form1 : Form { public Form1() { InitializeComponent(); List<int> quantities = new List<int>(); for (int i = 0; i < 100; i++) { quantities.Add(i); } comboBoxNumberOfProducts.DataSource = quantities; } private void comboBoxNumberOfProducts_SelectedIndexChanged(object sender, EventArgs e) { Service writing = new Writing((int) comboBoxNumberOfProducts.SelectedItem); Service analysis = new Analysis((int) comboBoxNumberOfProducts.SelectedItem); labelWriterHours.Text = writing.GetHours().ToString(); labelAnalysisHours.Text = analysis.GetHours().ToString(); } }

    Read the article

  • Choosing a scripting language for game and implementing it

    - by Radius
    Hello, I am currently developing a 3D Action/RPG game in C++, and I would like some advice in choosing a scripting language to program the AI of the game. My team comes from a modding background, and in fact we are still finishing work on a mod of the game Gothic. In that game (which we also got our inspiration from) the language DAEDALUS (created by Piranha Bytes, the makers of the game) is used. Here is a full description of said language. The main thing to notice about this is that it uses instances moreso than classes. The game engine is closed, and so one can only guess about the internal implementation of this language, but the main thing I am looking for in a scripting language (which ideally would be quite similar but preferably also more powerful than DAEDALUS) is the fact that there are de facto 3 'separations' of classes - ie classes, instances and (instances of instances?). I think it will be easier to understand what I want if I provide an example. Take a regular NPC. First of all you have a class defined which (I understand) mirrors the (class or structure) inside the engine: CLASS C_NPC { VAR INT id ; // absolute ID des NPCs VAR STRING name [5] ; // Namen des NPC VAR STRING slot ; VAR INT npcType ; VAR INT flags ; VAR INT attribute [ATR_INDEX_MAX] ; VAR INT protection [PROT_INDEX_MAX]; VAR INT damage [DAM_INDEX_MAX] ; VAR INT damagetype ; VAR INT guild,level ; VAR FUNC mission [MAX_MISSIONS] ; var INT fight_tactic ; VAR INT weapon ; VAR INT voice ; VAR INT voicePitch ; VAR INT bodymass ; VAR FUNC daily_routine ; // Tagesablauf VAR FUNC start_aistate ; // Zustandsgesteuert // ********************** // Spawn // ********************** VAR STRING spawnPoint ; // Beim Tod, wo respawnen ? VAR INT spawnDelay ; // Mit Delay in (Echtzeit)-Sekunden // ********************** // SENSES // ********************** VAR INT senses ; // Sinne VAR INT senses_range ; // Reichweite der Sinne in cm // ********************** // Feel free to use // ********************** VAR INT aivar [50] ; VAR STRING wp ; // ********************** // Experience dependant // ********************** VAR INT exp ; // EXerience Points VAR INT exp_next ; // EXerience Points needed to advance to next level VAR INT lp ; // Learn Points }; Then, you can also define prototypes (which set some default values). But how you actually define an NPC is like this: instance BAU_900_Ricelord (Npc_Default) //Inherit from prototype Npc_Default { //-------- primary data -------- name = "Ryzowy Ksiaze"; npctype = NPCTYPE_GUARD; guild = GIL_BAU; level = 10; voice = 12; id = 900; //-------- abilities -------- attribute[ATR_STRENGTH] = 50; attribute[ATR_DEXTERITY] = 10; attribute[ATR_MANA_MAX] = 0; attribute[ATR_MANA] = 0; attribute[ATR_HITPOINTS_MAX]= 170; attribute[ATR_HITPOINTS] = 170; //-------- visuals -------- // animations Mdl_SetVisual (self,"HUMANS.MDS"); Mdl_ApplyOverlayMds (self,"Humans_Arrogance.mds"); Mdl_ApplyOverlayMds (self,"HUMANS_DZIDA.MDS"); // body mesh ,bdytex,skin,head mesh ,headtex,teethtex,ruestung Mdl_SetVisualBody (self,"Hum_Body_CookSmith",1,1,"Hum_Head_FatBald",91 , 0,-1); B_Scale (self); Mdl_SetModelFatness(self,2); fight_tactic = FAI_HUMAN_STRONG; //-------- Talente -------- Npc_SetTalentSkill (self,NPC_TALENT_1H,1); //-------- inventory -------- CreateInvItems (self, ItFoRice,10); CreateInvItem (self, ItFoWine); CreateInvItems(self, ItMiNugget,40); EquipItem (self, Heerscherstab); EquipItem (self, MOD_AMULETTDESREISLORDS); CreateInvItem (self, ItMi_Alchemy_Moleratlubric_01); //CreateInvItem (self,ItKey_RB_01); EquipItem (self, Ring_des_Lebens); //-------------Daily Routine------------- daily_routine = Rtn_start_900; }; FUNC VOID Rtn_start_900 () { TA_Boss (07,00,20,00,"NC_RICELORD"); TA_SitAround (20,00,24,00,"NC_RICELORD_SIT"); TA_Sleep (24,00,07,00,"NC_RICEBUNKER_10"); }; As you can see, the instance declaration is more like a constructor function, setting values and calling functions from within. This still wouldn't pose THAT much of a problem, if not for one more thing: multiple copies of this instance. For example, you can spawn multiple BAU_900_Ricelord's, and each of them keeps track of its own AI state, hitpoints etc. Now I think the instances are represented as ints (maybe even as the id of the NPC) inside the engine, as whenever (inside the script) you use the expression BAU_900_Ricelord it can be only assigned to an int variable, and most functions that operate on NPCs take that int value. However to directly modify its hitpoints etc you have to do something like var C_NPC npc = GetNPC(Bau_900_Ricelord); npc.attribute[ATR_HITPOINTS] = 10; ie get the actual C_NPC object that represents it. To finally recap - is it possible to get this kind of behaviour in any scripting languages you know of, or am I stuck with having to make my own? Or maybe there is an even better way of representing NPC's and their behaviours that way. The IDEAL language for scripting for me would be C#, as I simply adore that language, but somehow I doubt it is possible or indeed feasible to try and implement a similar kind of behaviour in C#. Many thanks

    Read the article

  • JSF2 - Why does render response not rerender component setting?

    - by fekete-kamosh
    From the tutorial: "If the request is a postback and errors were encountered during the apply request values phase, process validations phase, or update model values phase, the original page is rendered during Render response phase" (http://java.sun.com/javaee/5/docs/tutorial/doc/bnaqq.html) Does it mean that if view is restored in "Restore View" phase and then any apply request/validation/update model phase fails and skips to "Render response" that Render response only passes restored view without any changes to client? Managed Bean: package cz.test; import javax.faces.bean.ManagedBean; import javax.faces.bean.RequestScoped; @ManagedBean @RequestScoped public class TesterBean { // Simple DataStore (in real world EJB) private static String storedSomeValue = null; private String someValue; public TesterBean() { } public String storeValue() { storedSomeValue = someValue; return "index"; } public String eraseValue() { storedSomeValue = null; return "index"; } public String getSomeValue() { someValue = storedSomeValue; return someValue; } public void setSomeValue(String someValue) { this.someValue = someValue; } } Composite component: <?xml version='1.0' encoding='ISO-8859-1' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:composite="http://java.sun.com/jsf/composite" xmlns:c="http://java.sun.com/jsp/jstl/core"> <!-- INTERFACE --> <composite:interface> <composite:attribute name="currentBehaviour" type="java.lang.String" required="true"/> <composite:attribute name="fieldValue" required="true"/> </composite:interface> <!-- IMPLEMENTATION --> <composite:implementation> <h:panelGrid columns="3"> <c:choose> <c:when test="#{cc.attrs.currentBehaviour == 'READONLY'}" > <h:outputText id="fieldValue" value="#{cc.attrs.fieldValue}"> </h:outputText> </c:when> <c:when test="#{cc.attrs.currentBehaviour == 'MANDATORY'}" > <h:inputText id="fieldValue" value="#{cc.attrs.fieldValue}" required="true"> <f:attribute name="requiredMessage" value="Field is mandatory"/> <c:if test="#{empty cc.attrs.fieldValue}"> <f:attribute name="style" value="background-color: yellow;"/> </c:if> </h:inputText>&nbsp;* </c:when> <c:when test="#{cc.attrs.currentBehaviour == 'OPTIONAL'}" > <h:inputText id="fieldValue" value="#{cc.attrs.fieldValue}"> </h:inputText> </c:when> </c:choose> <h:message for="fieldValue" style="color:red;" /> </h:panelGrid> </composite:implementation> Page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:ez="http://java.sun.com/jsf/composite/components"> <h:head> <title>Testing page</title> </h:head> <h:body> <h:form> <h:outputText value="Some value:"/> <ez:field-component currentBehaviour="MANDATORY" fieldValue="#{testerBean.someValue}"/> <h:commandButton value="Store" action="#{testerBean.storeValue}"/> <h:commandButton value="Erase" action="#{testerBean.eraseValue}" immediate="true"/> </h:form> <br/><br/> <b>Why is field's background color not set to yellow?</b> <ol> <li>NOTICE: Field has yellow background color (mandatory field with no value)</li> <li>Fill in any value (eg. "Hello") and press Store</li> <li>NOTICE: Yellow background disappeared (as mandatory field has value)</li> <li>Clear text in the field and press Store</li> <li><b>QUESTION: Why is field's background color not set to yellow?</b></li> <li>Press Erase</li> <li>NOTICE: Field has yellow background color (mandatory field with no value)</li> </ol> </h:body>

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • create new inbox folder and save emails

    - by kasunmit
    i am trying http://www.c-sharpcorner.com/uploadfile/rambab/outlookintegration10282006032802am/outlookintegration.aspx[^] this code for create inbox personal folder and save same mails at the datagrid view (outlook 2007 and vsto 2008) i am able to create inbox folder according to above example but couldn't wire code for save e-mails at that example to save contect they r using following code if (chkVerify.Checked) { OutLook._Application outlookObj = new OutLook.Application(); MyContact cntact = new MyContact(); cntact.CustomProperty = txtProp1.Text.Trim().ToString(); //CREATING CONTACT ITEM OBJECT AND FINDING THE CONTACT ITEM OutLook.ContactItem newContact = (OutLook.ContactItem)FindContactItem(cntact, CustomFolder); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . if (newContact != null) { newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if(string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } else { //IF THE CONTACT DOES NOT EXIST WITH SAME CUSTOM PROPERTY CREATES THE CONTACT. newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { OutLook._Application outlookObj = new OutLook.Application(); OutLook.ContactItem newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { //CREATES THE OUTLOOK CONTACT IN DEFAULT CONTACTS FOLDER. OutLook._Application outlookObj = new OutLook.Application(); OutLook.MAPIFolder fldContacts = (OutLook.MAPIFolder)outlookObj.Session.GetDefaultFolder(OutLook.OlDefaultFolders.olFolderContacts); OutLook.ContactItem newContact = (OutLook.ContactItem)fldContacts.Items.Add(OutLook.OlItemType.olContactItem); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); newContact.Save(); this.Close(); } } /// /// ENABLING AND DISABLING THE CUSTOM FOLDER AND PROPERY OPTIONS. /// /// /// private void rdoCustom_CheckedChanged(object sender, EventArgs e) { if (rdoCustom.Checked) { txFolder.Enabled = true; chkAdd.Enabled = true; chkVerify.Enabled = true; txtProp1.Enabled = true; } else { txFolder.Enabled = false; chkAdd.Enabled = false; chkVerify.Enabled = false; txtProp1.Enabled = false; } } i don t have idea to convert it to save e-mails in the datagrid view the data gride view i am mentioning here is containing details (sender address, subject etc.) of unread mails and the i i am did was perform some filter for that mails as follows string senderMailAddress = txtMailAddress.Text.ToLower(); List list = (List)dgvUnreadMails.DataSource; List myUnreadMailList; List filteredList = (List)(from ci in list where ci.SenderAddress.StartsWith(senderMailAddress) select ci).ToList(); dgvUnreadMails.DataSource = filteredList; it was done successfully then i need to save those filtered e-mails to that personal inbox folder i created already for that pls give me some help my issue is that how can i assign outlook object just like they assign it to contacts (name, address, e-mail etc.) because in the e-mails we couldn't find it ..

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • Windows Impersonation failed

    - by skprocks
    I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

    Read the article

  • Problem measuring N times the execution time of a code block

    - by Nazgulled
    EDIT: I just found my problem after writing this long post explaining every little detail... If someone can give me a good answer on what I'm doing wrong and how can I get the execution time in seconds (using a float with 5 decimal places or so), I'll mark that as accepted. Hint: The problem was on how I interpreted the clock_getttime() man page. Hi, Let's say I have a function named myOperation that I need to measure the execution time of. To measure it, I'm using clock_gettime() as it was recommend here in one of the comments. My teacher recommends us to measure it N times so we can get an average, standard deviation and median for the final report. He also recommends us to execute myOperation M times instead of just one. If myOperation is a very fast operation, measuring it M times allow us to get a sense of the "real time" it takes; cause the clock being used might not have the required precision to measure such operation. So, execution myOperation only one time or M times really depends if the operation itself takes long enough for the clock precision we are using. I'm having trouble dealing with that M times execution. Increasing M decreases (a lot) the final average value. Which doesn't make sense to me. It's like this, on average you take 3 to 5 seconds to travel from point A to B. But then you go from A to B and back to A 5 times (which makes it 10 times, cause A to B is the same as B to A) and you measure that. Than you divide by 10, the average you get is supposed to be the same average you take traveling from point A to B, which is 3 to 5 seconds. This is what I want my code to do, but it's not working. If I keep increasing the number of times I go from A to B and back A, the average will be lower and lower each time, it makes no sense to me. Enough theory, here's my code: #include <stdio.h> #include <time.h> #define MEASUREMENTS 1 #define OPERATIONS 1 typedef struct timespec TimeClock; TimeClock diffTimeClock(TimeClock start, TimeClock end) { TimeClock aux; if((end.tv_nsec - start.tv_nsec) < 0) { aux.tv_sec = end.tv_sec - start.tv_sec - 1; aux.tv_nsec = 1E9 + end.tv_nsec - start.tv_nsec; } else { aux.tv_sec = end.tv_sec - start.tv_sec; aux.tv_nsec = end.tv_nsec - start.tv_nsec; } return aux; } int main(void) { TimeClock sTime, eTime, dTime; int i, j; for(i = 0; i < MEASUREMENTS; i++) { printf(" » MEASURE %02d\n", i+1); clock_gettime(CLOCK_REALTIME, &sTime); for(j = 0; j < OPERATIONS; j++) { myOperation(); } clock_gettime(CLOCK_REALTIME, &eTime); dTime = diffTimeClock(sTime, eTime); printf(" - NSEC (TOTAL): %ld\n", dTime.tv_nsec); printf(" - NSEC (OP): %ld\n\n", dTime.tv_nsec / OPERATIONS); } return 0; } Notes: The above diffTimeClock function is from this blog post. I replaced my real operation with myOperation() because it doesn't make any sense to post my real functions as I would have to post long blocks of code, you can easily code a myOperation() with whatever you like to compile the code if you wish. As you can see, OPERATIONS = 1 and the results are: » MEASURE 01 - NSEC (TOTAL): 27456580 - NSEC (OP): 27456580 For OPERATIONS = 100 the results are: » MEASURE 01 - NSEC (TOTAL): 218929736 - NSEC (OP): 2189297 For OPERATIONS = 1000 the results are: » MEASURE 01 - NSEC (TOTAL): 862834890 - NSEC (OP): 862834 For OPERATIONS = 10000 the results are: » MEASURE 01 - NSEC (TOTAL): 574133641 - NSEC (OP): 57413 Now, I'm not a math wiz, far from it actually, but this doesn't make any sense to me whatsoever. I've already talked about this with a friend that's on this project with me and he also can't understand the differences. I don't understand why the value is getting lower and lower when I increase OPERATIONS. The operation itself should take the same time (on average of course, not the exact same time), no matter how many times I execute it. You could tell me that that actually depends on the operation itself, the data being read and that some data could already be in the cache and bla bla, but I don't think that's the problem. In my case, myOperation is reading 5000 lines of text from an CSV file, separating the values by ; and inserting those values into a data structure. For each iteration, I'm destroying the data structure and initializing it again. Now that I think of it, I also that think that there's a problem measuring time with clock_gettime(), maybe I'm not using it right. I mean, look at the last example, where OPERATIONS = 10000. The total time it took was 574133641ns, which would be roughly 0,5s; that's impossible, it took a couple of minutes as I couldn't stand looking at the screen waiting and went to eat something.

    Read the article

  • The Tab1.java from API Demo has exception.

    - by Kooper
    I don't know why.All my Tab programs have exception.Even from API Demo. Here is the code: package com.example.android.apis.view; import android.app.TabActivity; import android.os.Bundle; import android.widget.TabHost; import android.widget.TabHost.TabSpec; import android.view.LayoutInflater; import android.view.View; public class Tab1 extends TabActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); TabHost tabHost = getTabHost(); LayoutInflater.from(this).inflate(R.layout.main,tabHost.getTabContentView(), true); tabHost.addTab(tabHost.newTabSpec("tab1") .setIndicator("tab1") .setContent(R.id.view1)); tabHost.addTab(tabHost.newTabSpec("tab2") .setIndicator("tab2") .setContent(R.id.view2)); tabHost.addTab(tabHost.newTabSpec("tab3") .setIndicator("tab3") .setContent(R.id.view3)); } } Here is the log: 06-13 17:24:38.336: WARN/jdwp(262): Debugger is telling the VM to exit with code=1 06-13 17:24:38.336: INFO/dalvikvm(262): GC lifetime allocation: 2511 bytes 06-13 17:24:38.416: DEBUG/Zygote(30): Process 262 exited cleanly (1) 06-13 17:24:38.456: INFO/ActivityManager(54): Process com.example.android.apis.view (pid 262) has died. 06-13 17:24:38.696: INFO/UsageStats(54): Unexpected resume of com.android.launcher while already resumed in com.example.android.apis.view 06-13 17:24:38.736: WARN/InputManagerService(54): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@44dc4b38 06-13 17:24:48.337: DEBUG/AndroidRuntime(269): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:48.346: DEBUG/AndroidRuntime(269): CheckJNI is ON 06-13 17:24:48.856: DEBUG/AndroidRuntime(269): --- registering native functions --- 06-13 17:24:49.596: DEBUG/ddm-heap(269): Got feature list request 06-13 17:24:50.576: DEBUG/AndroidRuntime(269): Shutting down VM 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM shutting VM down 06-13 17:24:50.576: DEBUG/dalvikvm(269): HeapWorker thread shutting down 06-13 17:24:50.586: DEBUG/dalvikvm(269): HeapWorker thread has shut down 06-13 17:24:50.586: DEBUG/jdwp(269): JDWP shutting down net... 06-13 17:24:50.586: INFO/dalvikvm(269): Debugger has detached; object registry had 1 entries 06-13 17:24:50.596: ERROR/AndroidRuntime(269): ERROR: thread attach failed 06-13 17:24:50.606: DEBUG/dalvikvm(269): VM cleaning up 06-13 17:24:50.676: DEBUG/dalvikvm(269): LinearAlloc 0x0 used 628628 of 5242880 (11%) 06-13 17:24:51.476: DEBUG/AndroidRuntime(278): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:51.486: DEBUG/AndroidRuntime(278): CheckJNI is ON 06-13 17:24:51.986: DEBUG/AndroidRuntime(278): --- registering native functions --- 06-13 17:24:52.746: DEBUG/ddm-heap(278): Got feature list request 06-13 17:24:53.716: DEBUG/ActivityManager(54): Uninstalling process com.example.android.apis.view 06-13 17:24:53.726: INFO/ActivityManager(54): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.example.android.apis.view/.Tab1 } 06-13 17:24:53.876: DEBUG/AndroidRuntime(278): Shutting down VM 06-13 17:24:53.886: DEBUG/dalvikvm(278): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:53.916: DEBUG/dalvikvm(278): DestroyJavaVM shutting VM down 06-13 17:24:53.926: DEBUG/dalvikvm(278): HeapWorker thread shutting down 06-13 17:24:53.936: DEBUG/dalvikvm(278): HeapWorker thread has shut down 06-13 17:24:53.936: DEBUG/jdwp(278): JDWP shutting down net... 06-13 17:24:53.936: INFO/dalvikvm(278): Debugger has detached; object registry had 1 entries 06-13 17:24:53.957: DEBUG/dalvikvm(278): VM cleaning up 06-13 17:24:54.026: ERROR/AndroidRuntime(278): ERROR: thread attach failed 06-13 17:24:54.146: DEBUG/dalvikvm(278): LinearAlloc 0x0 used 638596 of 5242880 (12%) 06-13 17:24:54.286: INFO/ActivityManager(54): Start proc com.example.android.apis.view for activity com.example.android.apis.view/.Tab1: pid=285 uid=10054 gids={1015} 06-13 17:24:54.676: DEBUG/ddm-heap(285): Got feature list request 06-13 17:24:55.006: WARN/ActivityThread(285): Application com.example.android.apis.view is waiting for the debugger on port 8100... 06-13 17:24:55.126: INFO/System.out(285): Sending WAIT chunk 06-13 17:24:55.186: INFO/dalvikvm(285): Debugger is active 06-13 17:24:55.378: INFO/System.out(285): Debugger has connected 06-13 17:24:55.386: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.586: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.796: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.996: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.196: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.406: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.606: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.806: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.016: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.216: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.416: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.626: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.836: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.039: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.246: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.451: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.656: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.866: INFO/System.out(285): debugger has settled (1367) 06-13 17:24:59.126: ERROR/gralloc(54): [unregister] handle 0x129980 still locked (state=40000001) 06-13 17:25:03.816: WARN/ActivityManager(54): Launch timeout has expired, giving up wake lock! 06-13 17:25:04.906: WARN/ActivityManager(54): Activity idle timeout for HistoryRecord{44d60e10 com.example.android.apis.view/.Tab1}

    Read the article

  • Duplex communication using NetTcpBinding - ContractFilter mismatch?

    - by Shaul
    I'm making slow and steady progress towards having a duplex communication channel open between a client and a server, using NetTcpBinding. (FYI, you can observe my newbie progress here and here!) I'm now at the stage where I have successfully connected to my server, through the server's firewall, and the client can make requests of the server. In the other direction, however, things aren't quite so happy. It works fine when testing on my own machine, but when testing over the internet, when I try to initiate a callback from the server side, I get an error: The message with Action 'http://MyWebService/IWebService/HelloWorld' cannot be processed at the receiver, due to a ContractFilter mismatch at the EndpointDispatcher. This may be because of either a contract mismatch (mismatched Actions between sender and receiver) or a binding/security mismatch between the sender and the receiver. Check that sender and receiver have the same contract and the same binding (including security requirements, e.g. Message, Transport, None). Here are some of the key bits of code. First, the web interface: [ServiceContract(Namespace = "http://MyWebService", SessionMode = SessionMode.Required, CallbackContract = typeof(ISiteServiceExternal))] public interface IWebService { [OperationContract] void Register(long customerID); } public interface ISiteServiceExternal { [OperationContract] string HelloWorld(); } Then, on the client side (I was fiddling with these attributes without really knowing what I'm doing): [ServiceBehavior(InstanceContextMode = InstanceContextMode.PerSession, Namespace="http://MyWebService")] class SiteServer : IWebServiceCallback { string IWebServiceCallback.HelloWorld() { return "Hello World!"; } ... } So what am I doing wrong here? EDIT: Adding app.config code. From server: <system.serviceModel> <diagnostics> <messageLogging logMalformedMessages="true" logMessagesAtServiceLevel="true" logMessagesAtTransportLevel="true" logEntireMessage="true" maxMessagesToLog="1000" maxSizeOfMessageToLog="524288" /> </diagnostics> <behaviors> <serviceBehaviors> <behavior name="mex"> <serviceDebug includeExceptionDetailInFaults="true"/> <serviceMetadata/> </behavior> </serviceBehaviors> </behaviors> <services> <service name ="MyWebService.WebService" behaviorConfiguration="mex"> <endpoint address="net.tcp://localhost:8000" binding="netTcpBinding" contract="MyWebService.IWebService" bindingConfiguration="TestBinding" name="MyEndPoint"></endpoint> <endpoint address ="mex" binding="mexTcpBinding" name="MEX" contract="IMetadataExchange"/> <host> <baseAddresses> <add baseAddress="net.tcp://localhost:8000"/> </baseAddresses> </host> </service> </services> <bindings> <netTcpBinding> <binding name="TestBinding" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" portSharingEnabled="false"> <readerQuotas maxDepth="32" maxStringContentLength ="8192" maxArrayLength ="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384"/> <security mode="None"/> </binding> </netTcpBinding> </bindings> </system.serviceModel> and on the client side: <system.serviceModel> <bindings> <netTcpBinding> <binding name="MyEndPoint" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" transactionFlow="false" transferMode="Buffered" transactionProtocol="OleTransactions" hostNameComparisonMode="StrongWildcard" listenBacklog="10" maxBufferPoolSize="524288" maxBufferSize="65536" maxConnections="10" maxReceivedMessageSize="65536"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="false" /> <security mode="None"> <transport clientCredentialType="Windows" protectionLevel="EncryptAndSign"> <extendedProtectionPolicy policyEnforcement="Never" /> </transport> <message clientCredentialType="Windows" /> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint address="net.tcp://mydomain.gotdns.com:8000/" binding="netTcpBinding" bindingConfiguration="MyEndPoint" contract="IWebService" name="MyEndPoint" /> </client> </system.serviceModel>

    Read the article

  • C#/.NET Little Wonders: Interlocked CompareExchange()

    - by James Michael Hare
    Once again, in this series of posts I look at the parts of the .NET Framework that may seem trivial, but can help improve your code by making it easier to write and maintain. The index of all my past little wonders posts can be found here. Two posts ago, I discussed the Interlocked Add(), Increment(), and Decrement() methods (here) for adding and subtracting values in a thread-safe, lightweight manner.  Then, last post I talked about the Interlocked Read() and Exchange() methods (here) for safely and efficiently reading and setting 32 or 64 bit values (or references).  This week, we’ll round out the discussion by talking about the Interlocked CompareExchange() method and how it can be put to use to exchange a value if the current value is what you expected it to be. Dirty reads can lead to bad results Many of the uses of Interlocked that we’ve explored so far have centered around either reading, setting, or adding values.  But what happens if you want to do something more complex such as setting a value based on the previous value in some manner? Perhaps you were creating an application that reads a current balance, applies a deposit, and then saves the new modified balance, where of course you’d want that to happen atomically.  If you read the balance, then go to save the new balance and between that time the previous balance has already changed, you’ll have an issue!  Think about it, if we read the current balance as $400, and we are applying a new deposit of $50.75, but meanwhile someone else deposits $200 and sets the total to $600, but then we write a total of $450.75 we’ve lost $200! Now, certainly for int and long values we can use Interlocked.Add() to handles these cases, and it works well for that.  But what if we want to work with doubles, for example?  Let’s say we wanted to add the numbers from 0 to 99,999 in parallel.  We could do this by spawning several parallel tasks to continuously add to a total: 1: double total = 0; 2:  3: Parallel.For(0, 10000, next => 4: { 5: total += next; 6: }); Were this run on one thread using a standard for loop, we’d expect an answer of 4,999,950,000 (the sum of all numbers from 0 to 99,999).  But when we run this in parallel as written above, we’ll likely get something far off.  The result of one of my runs, for example, was 1,281,880,740.  That is way off!  If this were banking software we’d be in big trouble with our clients.  So what happened?  The += operator is not atomic, it will read in the current value, add the result, then store it back into the total.  At any point in all of this another thread could read a “dirty” current total and accidentally “skip” our add.   So, to clean this up, we could use a lock to guarantee concurrency: 1: double total = 0.0; 2: object locker = new object(); 3:  4: Parallel.For(0, count, next => 5: { 6: lock (locker) 7: { 8: total += next; 9: } 10: }); Which will give us the correct result of 4,999,950,000.  One thing to note is that locking can be heavy, especially if the operation being locked over is trivial, or the life of the lock is a high percentage of the work being performed concurrently.  In the case above, the lock consumes pretty much all of the time of each parallel task – and the task being locked on is relatively trivial. Now, let me put in a disclaimer here before we go further: For most uses, lock is more than sufficient for your needs, and is often the simplest solution!    So, if lock is sufficient for most needs, why would we ever consider another solution?  The problem with locking is that it can suspend execution of your thread while it waits for the signal that the lock is free.  Moreover, if the operation being locked over is trivial, the lock can add a very high level of overhead.  This is why things like Interlocked.Increment() perform so well, instead of locking just to perform an increment, we perform the increment with an atomic, lockless method. As with all things performance related, it’s important to profile before jumping to the conclusion that you should optimize everything in your path.  If your profiling shows that locking is causing a high level of waiting in your application, then it’s time to consider lighter alternatives such as Interlocked. CompareExchange() – Exchange existing value if equal some value So let’s look at how we could use CompareExchange() to solve our problem above.  The general syntax of CompareExchange() is: T CompareExchange<T>(ref T location, T newValue, T expectedValue) If the value in location == expectedValue, then newValue is exchanged.  Either way, the value in location (before exchange) is returned. Actually, CompareExchange() is not one method, but a family of overloaded methods that can take int, long, float, double, pointers, or references.  It cannot take other value types (that is, can’t CompareExchange() two DateTime instances directly).  Also keep in mind that the version that takes any reference type (the generic overload) only checks for reference equality, it does not call any overridden Equals(). So how does this help us?  Well, we can grab the current total, and exchange the new value if total hasn’t changed.  This would look like this: 1: // grab the snapshot 2: double current = total; 3:  4: // if the total hasn’t changed since I grabbed the snapshot, then 5: // set it to the new total 6: Interlocked.CompareExchange(ref total, current + next, current); So what the code above says is: if the amount in total (1st arg) is the same as the amount in current (3rd arg), then set total to current + next (2nd arg).  This check and exchange pair is atomic (and thus thread-safe). This works if total is the same as our snapshot in current, but the problem, is what happens if they aren’t the same?  Well, we know that in either case we will get the previous value of total (before the exchange), back as a result.  Thus, we can test this against our snapshot to see if it was the value we expected: 1: // if the value returned is != current, then our snapshot must be out of date 2: // which means we didn't (and shouldn't) apply current + next 3: if (Interlocked.CompareExchange(ref total, current + next, current) != current) 4: { 5: // ooops, total was not equal to our snapshot in current, what should we do??? 6: } So what do we do if we fail?  That’s up to you and the problem you are trying to solve.  It’s possible you would decide to abort the whole transaction, or perhaps do a lightweight spin and try again.  Let’s try that: 1: double current = total; 2:  3: // make first attempt... 4: if (Interlocked.CompareExchange(ref total, current + i, current) != current) 5: { 6: // if we fail, go into a spin wait, spin, and try again until succeed 7: var spinner = new SpinWait(); 8:  9: do 10: { 11: spinner.SpinOnce(); 12: current = total; 13: } 14: while (Interlocked.CompareExchange(ref total, current + i, current) != current); 15: } 16:  This is not trivial code, but it illustrates a possible use of CompareExchange().  What we are doing is first checking to see if we succeed on the first try, and if so great!  If not, we create a SpinWait and then repeat the process of SpinOnce(), grab a fresh snapshot, and repeat until CompareExchnage() succeeds.  You may wonder why not a simple do-while here, and the reason it’s more efficient to only create the SpinWait until we absolutely know we need one, for optimal efficiency. Though not as simple (or maintainable) as a simple lock, this will perform better in many situations.  Comparing an unlocked (and wrong) version, a version using lock, and the Interlocked of the code, we get the following average times for multiple iterations of adding the sum of 100,000 numbers: 1: Unlocked money average time: 2.1 ms 2: Locked money average time: 5.1 ms 3: Interlocked money average time: 3 ms So the Interlocked.CompareExchange(), while heavier to code, came in lighter than the lock, offering a good compromise of safety and performance when we need to reduce contention. CompareExchange() - it’s not just for adding stuff… So that was one simple use of CompareExchange() in the context of adding double values -- which meant we couldn’t have used the simpler Interlocked.Add() -- but it has other uses as well. If you think about it, this really works anytime you want to create something new based on a current value without using a full lock.  For example, you could use it to create a simple lazy instantiation implementation.  In this case, we want to set the lazy instance only if the previous value was null: 1: public static class Lazy<T> where T : class, new() 2: { 3: private static T _instance; 4:  5: public static T Instance 6: { 7: get 8: { 9: // if current is null, we need to create new instance 10: if (_instance == null) 11: { 12: // attempt create, it will only set if previous was null 13: Interlocked.CompareExchange(ref _instance, new T(), (T)null); 14: } 15:  16: return _instance; 17: } 18: } 19: } So, if _instance == null, this will create a new T() and attempt to exchange it with _instance.  If _instance is not null, then it does nothing and we discard the new T() we created. This is a way to create lazy instances of a type where we are more concerned about locking overhead than creating an accidental duplicate which is not used.  In fact, the BCL implementation of Lazy<T> offers a similar thread-safety choice for Publication thread safety, where it will not guarantee only one instance was created, but it will guarantee that all readers get the same instance.  Another possible use would be in concurrent collections.  Let’s say, for example, that you are creating your own brand new super stack that uses a linked list paradigm and is “lock free”.  We could use Interlocked.CompareExchange() to be able to do a lockless Push() which could be more efficient in multi-threaded applications where several threads are pushing and popping on the stack concurrently. Yes, there are already concurrent collections in the BCL (in .NET 4.0 as part of the TPL), but it’s a fun exercise!  So let’s assume we have a node like this: 1: public sealed class Node<T> 2: { 3: // the data for this node 4: public T Data { get; set; } 5:  6: // the link to the next instance 7: internal Node<T> Next { get; set; } 8: } Then, perhaps, our stack’s Push() operation might look something like: 1: public sealed class SuperStack<T> 2: { 3: private volatile T _head; 4:  5: public void Push(T value) 6: { 7: var newNode = new Node<int> { Data = value, Next = _head }; 8:  9: if (Interlocked.CompareExchange(ref _head, newNode, newNode.Next) != newNode.Next) 10: { 11: var spinner = new SpinWait(); 12:  13: do 14: { 15: spinner.SpinOnce(); 16: newNode.Next = _head; 17: } 18: while (Interlocked.CompareExchange(ref _head, newNode, newNode.Next) != newNode.Next); 19: } 20: } 21:  22: // ... 23: } Notice a similar paradigm here as with adding our doubles before.  What we are doing is creating the new Node with the data to push, and with a Next value being the original node referenced by _head.  This will create our stack behavior (LIFO – Last In, First Out).  Now, we have to set _head to now refer to the newNode, but we must first make sure it hasn’t changed! So we check to see if _head has the same value we saved in our snapshot as newNode.Next, and if so, we set _head to newNode.  This is all done atomically, and the result is _head’s original value, as long as the original value was what we assumed it was with newNode.Next, then we are good and we set it without a lock!  If not, we SpinWait and try again. Once again, this is much lighter than locking in highly parallelized code with lots of contention.  If I compare the method above with a similar class using lock, I get the following results for pushing 100,000 items: 1: Locked SuperStack average time: 6 ms 2: Interlocked SuperStack average time: 4.5 ms So, once again, we can get more efficient than a lock, though there is the cost of added code complexity.  Fortunately for you, most of the concurrent collection you’d ever need are already created for you in the System.Collections.Concurrent (here) namespace – for more information, see my Little Wonders – The Concurent Collections Part 1 (here), Part 2 (here), and Part 3 (here). Summary We’ve seen before how the Interlocked class can be used to safely and efficiently add, increment, decrement, read, and exchange values in a multi-threaded environment.  In addition to these, Interlocked CompareExchange() can be used to perform more complex logic without the need of a lock when lock contention is a concern. The added efficiency, though, comes at the cost of more complex code.  As such, the standard lock is often sufficient for most thread-safety needs.  But if profiling indicates you spend a lot of time waiting for locks, or if you just need a lock for something simple such as an increment, decrement, read, exchange, etc., then consider using the Interlocked class’s methods to reduce wait. Technorati Tags: C#,CSharp,.NET,Little Wonders,Interlocked,CompareExchange,threading,concurrency

    Read the article

  • Fluent NHibernate/SQL Server 2008 insert query problem

    - by Mark
    Hi all, I'm new to Fluent NHibernate and I'm running into a problem. I have a mapping defined as follows: public PersonMapping() { Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.FirstName).Not.Nullable().Length(50); Map(p => p.MiddleInitial).Nullable().Length(1); Map(p => p.LastName).Not.Nullable().Length(50); Map(p => p.Suffix).Nullable().Length(3); Map(p => p.SSN).Nullable().Length(11); Map(p => p.BirthDate).Nullable(); Map(p => p.CellPhone).Nullable().Length(12); Map(p => p.HomePhone).Nullable().Length(12); Map(p => p.WorkPhone).Nullable().Length(12); Map(p => p.OtherPhone).Nullable().Length(12); Map(p => p.EmailAddress).Nullable().Length(50); Map(p => p.DriversLicenseNumber).Nullable().Length(50); Component<Address>(p => p.CurrentAddress, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); Map(p => p.EyeColor).Nullable().Length(3); Map(p => p.HairColor).Nullable().Length(3); Map(p => p.Gender).Nullable().Length(1); Map(p => p.Height).Nullable(); Map(p => p.Weight).Nullable(); Map(p => p.Race).Nullable().Length(1); Map(p => p.SkinTone).Nullable().Length(3); HasMany(p => p.PriorAddresses).Cascade.All(); } public PreviousAddressMapping() { Table("PriorAddress"); Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.EndEffectiveDate).Not.Nullable(); Component<Address>(p => p.Address, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); } My test is [Test] public void can_correctly_map_Person_with_Addresses() { var myPerson = new Person("Jane", "", "Doe"); var priorAddresses = new[] { new PreviousAddress(ObjectMother.GetAddress1(), DateTime.Parse("05/13/2010")), new PreviousAddress(ObjectMother.GetAddress2(), DateTime.Parse("05/20/2010")) }; new PersistenceSpecification<Person>(Session) .CheckProperty(c => c.FirstName, myPerson.FirstName) .CheckProperty(c => c.LastName, myPerson.LastName) .CheckProperty(c => c.MiddleInitial, myPerson.MiddleInitial) .CheckList(c => c.PriorAddresses, priorAddresses) .VerifyTheMappings(); } GetAddress1() (yeah, horrible name) has Line2 == null The tables seem to be created correctly in sql server 2008, but the test fails with a SQLException "String or binary data would be truncated." When I grab the sql statement in SQL Profiler, I get exec sp_executesql N'INSERT INTO PriorAddress (Line1, Line2, City, State, Zip, EndEffectiveDate, Id) VALUES (@p0, @p1, @p2, @p3, @p4, @p5, @p6)',N'@p0 nvarchar(18),@p1 nvarchar(4000),@p2 nvarchar(10),@p3 nvarchar(2),@p4 nvarchar(5),@p5 datetime,@p6 int',@p0=N'6789 Somewhere Rd.',@p1=NULL,@p2=N'Hot Coffee',@p3=N'MS',@p4=N'09876',@p5='2010-05-13 00:00:00',@p6=1001 Notice the @p1 parameter is being set to nvarchar(4000) and being passed a NULL value. Why is it setting the parameter to nvarchar(4000)? How can I fix it? Thanks!

    Read the article

  • Exception - Illegal Block size during decryption(Android)

    - by Vamsi
    I am writing an application which encrypts and decrypts the user notes based on the user set password. i used the following algorithms for encryption/decryption 1. PBEWithSHA256And256BitAES-CBC-BC 2. PBEWithMD5And128BitAES-CBC-OpenSSL e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); e_Cipher.init() d_Cipher.init() encryption is working well, but when trying to decrypt it gives Exception - Illegal Block size after encryption i am converting the cipherText to HEX and storing it in a sqlite database. i am retrieving correct values from the sqlite database during decyption but when calling d_Cipher.dofinal() it throws the Exception. I thought i missed to specify the padding and tried to check what are the other available cipher algorithms but i was unable to found. so request you to please give the some knowledge on what are the cipher algorithms and padding that are supported by Android? if the algorithm which i used can be used for padding, how should i specify the padding mechanism? I am pretty new to Encryption so tried a couple of algorithms which are available in BouncyCastle.java but unsuccessful. As requested here is the code public class CryptoHelper { private static final String TAG = "CryptoHelper"; //private static final String PBEWithSHA256And256BitAES = "PBEWithSHA256And256BitAES-CBC-BC"; //private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSL"; private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSLPBEWITHSHA1AND3-KEYTRIPLEDES-CB"; private static final String randomAlgorithm = "SHA1PRNG"; public static final int SALT_LENGTH = 8; public static final int SALT_GEN_ITER_COUNT = 20; private final static String HEX = "0123456789ABCDEF"; private Cipher e_Cipher; private Cipher d_Cipher; private SecretKey secretKey; private byte salt[]; public CryptoHelper(String password) throws InvalidKeyException, NoSuchAlgorithmException, NoSuchPaddingException, InvalidAlgorithmParameterException, InvalidKeySpecException { char[] cPassword = password.toCharArray(); PBEKeySpec pbeKeySpec = new PBEKeySpec(cPassword); PBEParameterSpec pbeParamSpec = new PBEParameterSpec(salt, SALT_GEN_ITER_COUNT); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); secretKey = keyFac.generateSecret(pbeKeySpec); SecureRandom saltGen = SecureRandom.getInstance(randomAlgorithm); this.salt = new byte[SALT_LENGTH]; saltGen.nextBytes(this.salt); e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); e_Cipher.init(Cipher.ENCRYPT_MODE, secretKey, pbeParamSpec); d_Cipher.init(Cipher.DECRYPT_MODE, secretKey, pbeParamSpec); } public String encrypt(String cleartext) throws IllegalBlockSizeException, BadPaddingException { byte[] encrypted = e_Cipher.doFinal(cleartext.getBytes()); return convertByteArrayToHex(encrypted); } public String decrypt(String cipherString) throws IllegalBlockSizeException { byte[] plainText = decrypt(convertStringtobyte(cipherString)); return(new String(plainText)); } public byte[] decrypt(byte[] ciphertext) throws IllegalBlockSizeException { byte[] retVal = {(byte)0x00}; try { retVal = d_Cipher.doFinal(ciphertext); } catch (BadPaddingException e) { Log.e(TAG, e.toString()); } return retVal; } public String convertByteArrayToHex(byte[] buf) { if (buf == null) return ""; StringBuffer result = new StringBuffer(2*buf.length); for (int i = 0; i < buf.length; i++) { appendHex(result, buf[i]); } return result.toString(); } private static void appendHex(StringBuffer sb, byte b) { sb.append(HEX.charAt((b>>4)&0x0f)).append(HEX.charAt(b&0x0f)); } private static byte[] convertStringtobyte(String hexString) { int len = hexString.length()/2; byte[] result = new byte[len]; for (int i = 0; i < len; i++) { result[i] = Integer.valueOf(hexString.substring(2*i, 2*i+2), 16).byteValue(); } return result; } public byte[] getSalt() { return salt; } public SecretKey getSecretKey() { return secretKey; } public static SecretKey createSecretKey(char[] password) throws NoSuchAlgorithmException, InvalidKeySpecException { PBEKeySpec pbeKeySpec = new PBEKeySpec(password); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); return keyFac.generateSecret(pbeKeySpec); } } I will call mCryptoHelper.decrypt(String str) then this results in Illegal block size exception My Env: Android 1.6 on Eclipse

    Read the article

  • Stuck with the first record while parsing an XML in Java

    - by Ritwik G
    I am parsing the following XML : <table ID="customer"> <T><C_CUSTKEY>1</C_CUSTKEY><C_NAME>Customer#000000001</C_NAME><C_ADDRESS>IVhzIApeRb ot,c,E</C_ADDRESS><C_NATIONKEY>15</C_NATIONKEY><C_PHONE>25-989-741-2988</C_PHONE><C_ACCTBAL>711.56</C_ACCTBAL><C_MKTSEGMENT>BUILDING</C_MKTSEGMENT><C_COMMENT>regular, regular platelets are fluffily according to the even attainments. blithely iron</C_COMMENT></T> <T><C_CUSTKEY>2</C_CUSTKEY><C_NAME>Customer#000000002</C_NAME><C_ADDRESS>XSTf4,NCwDVaWNe6tEgvwfmRchLXak</C_ADDRESS><C_NATIONKEY>13</C_NATIONKEY><C_PHONE>23-768-687-3665</C_PHONE><C_ACCTBAL>121.65</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>furiously special deposits solve slyly. furiously even foxes wake alongside of the furiously ironic ideas. pending</C_COMMENT></T> <T><C_CUSTKEY>3</C_CUSTKEY><C_NAME>Customer#000000003</C_NAME><C_ADDRESS>MG9kdTD2WBHm</C_ADDRESS><C_NATIONKEY>1</C_NATIONKEY><C_PHONE>11-719-748-3364</C_PHONE><C_ACCTBAL>7498.12</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>special packages wake. slyly reg</C_COMMENT></T> <T><C_CUSTKEY>4</C_CUSTKEY><C_NAME>Customer#000000004</C_NAME><C_ADDRESS>XxVSJsLAGtn</C_ADDRESS><C_NATIONKEY>4</C_NATIONKEY><C_PHONE>14-128-190-5944</C_PHONE><C_ACCTBAL>2866.83</C_ACCTBAL><C_MKTSEGMENT>MACHINERY</C_MKTSEGMENT><C_COMMENT>slyly final accounts sublate carefully. slyly ironic asymptotes nod across the quickly regular pack</C_COMMENT></T> <T><C_CUSTKEY>5</C_CUSTKEY><C_NAME>Customer#000000005</C_NAME><C_ADDRESS>KvpyuHCplrB84WgAiGV6sYpZq7Tj</C_ADDRESS><C_NATIONKEY>3</C_NATIONKEY><C_PHONE>13-750-942-6364</C_PHONE><C_ACCTBAL>794.47</C_ACCTBAL><C_MKTSEGMENT>HOUSEHOLD</C_MKTSEGMENT><C_COMMENT>blithely final instructions haggle; stealthy sauternes nod; carefully regu</C_COMMENT></T> </table> with the following java code: package xmlparserformining; import java.util.List; import java.util.Iterator; import org.dom4j.Document; import org.dom4j.DocumentException; import org.dom4j.Node; import org.dom4j.io.SAXReader; public class XmlParserForMining { public static Document getDocument( final String xmlFileName ) { Document document = null; SAXReader reader = new SAXReader(); try { document = reader.read( xmlFileName ); } catch (DocumentException e) { e.printStackTrace(); } return document; } public static void main(String[] args) { String xmlFileName = "/home/r/javaCodez/parsing in java/customer.xml"; String xPath = "//table/T/C_ADDRESS"; Document document = getDocument( xmlFileName ); List<Node> nodes = document.selectNodes( xPath ); System.out.println(nodes.size()); for (Node node : nodes) { String customer_address = node.valueOf(xPath); System.out.println( "Customer address: " + customer_address); } } } However, instead of getting all the various customer records, I am getting the following output: 1500 Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E and so on .. What is wrong here? Why is it printing only the first record ?

    Read the article

  • C# 'is' type check on struct - odd .NET 4.0 x86 optimization behavior

    - by Jacob Stanley
    Since upgrading to VS2010 I'm getting some very strange behavior with the 'is' keyword. The program below (test.cs) outputs True when compiled in debug mode (for x86) and False when compiled with optimizations on (for x86). Compiling all combinations in x64 or AnyCPU gives the expected result, True. All combinations of compiling under .NET 3.5 give the expected result, True. I'm using the batch file below (runtest.bat) to compile and test the code using various combinations of compiler .NET framework. Has anyone else seen these kind of problems under .NET 4.0? Does everyone else see the same behavior as me on their computer when running runtests.bat? #@$@#$?? Is there a fix for this? test.cs using System; public class Program { public static bool IsGuid(object item) { return item is Guid; } public static void Main() { Console.Write(IsGuid(Guid.NewGuid())); } } runtest.bat @echo off rem Usage: rem runtest -- runs with csc.exe x86 .NET 4.0 rem runtest 64 -- runs with csc.exe x64 .NET 4.0 rem runtest v3.5 -- runs with csc.exe x86 .NET 3.5 rem runtest v3.5 64 -- runs with csc.exe x64 .NET 3.5 set version=v4.0.30319 set platform=Framework for %%a in (%*) do ( if "%%a" == "64" (set platform=Framework64) if "%%a" == "v3.5" (set version=v3.5) ) echo Compiler: %platform%\%version%\csc.exe set csc="C:\Windows\Microsoft.NET\%platform%\%version%\csc.exe" set make=%csc% /nologo /nowarn:1607 test.cs rem CS1607: Referenced assembly targets a different processor rem This happens if you compile for x64 using csc32, or x86 using csc64 %make% /platform:x86 test.exe echo =^> x86 %make% /platform:x86 /optimize test.exe echo =^> x86 (Optimized) %make% /platform:x86 /debug test.exe echo =^> x86 (Debug) %make% /platform:x86 /debug /optimize test.exe echo =^> x86 (Debug + Optimized) %make% /platform:x64 test.exe echo =^> x64 %make% /platform:x64 /optimize test.exe echo =^> x64 (Optimized) %make% /platform:x64 /debug test.exe echo =^> x64 (Debug) %make% /platform:x64 /debug /optimize test.exe echo =^> x64 (Debug + Optimized) %make% /platform:AnyCPU test.exe echo =^> AnyCPU %make% /platform:AnyCPU /optimize test.exe echo =^> AnyCPU (Optimized) %make% /platform:AnyCPU /debug test.exe echo =^> AnyCPU (Debug) %make% /platform:AnyCPU /debug /optimize test.exe echo =^> AnyCPU (Debug + Optimized) Test Results When running the runtest.bat I get the following results on my Win7 x64 install. > runtest 32 v4.0 Compiler: Framework\v4.0.30319\csc.exe False => x86 False => x86 (Optimized) True => x86 (Debug) False => x86 (Debug + Optimized) True => x64 True => x64 (Optimized) True => x64 (Debug) True => x64 (Debug + Optimized) True => AnyCPU True => AnyCPU (Optimized) True => AnyCPU (Debug) True => AnyCPU (Debug + Optimized) > runtest 64 v4.0 Compiler: Framework64\v4.0.30319\csc.exe False => x86 False => x86 (Optimized) True => x86 (Debug) False => x86 (Debug + Optimized) True => x64 True => x64 (Optimized) True => x64 (Debug) True => x64 (Debug + Optimized) True => AnyCPU True => AnyCPU (Optimized) True => AnyCPU (Debug) True => AnyCPU (Debug + Optimized) > runtest 32 v3.5 Compiler: Framework\v3.5\csc.exe True => x86 True => x86 (Optimized) True => x86 (Debug) True => x86 (Debug + Optimized) True => x64 True => x64 (Optimized) True => x64 (Debug) True => x64 (Debug + Optimized) True => AnyCPU True => AnyCPU (Optimized) True => AnyCPU (Debug) True => AnyCPU (Debug + Optimized) > runtest 64 v3.5 Compiler: Framework64\v3.5\csc.exe True => x86 True => x86 (Optimized) True => x86 (Debug) True => x86 (Debug + Optimized) True => x64 True => x64 (Optimized) True => x64 (Debug) True => x64 (Debug + Optimized) True => AnyCPU True => AnyCPU (Optimized) True => AnyCPU (Debug) True => AnyCPU (Debug + Optimized) tl;dr

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • Asks for Account Type twice

    - by André Fecteau
    Been working on this program for a while now. (had some problems and asked a few times here.) Ran into another one though! The program asks for my account type twice. Can not figure out why or how to fix it. Any help is appreciated, thanks! /* project3.cpp Andre Fecteau CSC135-101 October 29, 2013 This program prints a bank's service fees per month depending on account type */ #include <iostream> using namespace std; /* Basic Function for Copy Paste <function type> <function name> (){ // Declarations // Initalizations // Input // Process // Output // Prolouge } */ void displayInstructions (){ // Declarations // Initalizations // Input // Process // Output cout <<"| -------------------------------------------------------------- |" << endl; cout <<"| ---------- Welcome to the bank fee calculator ---------------- |" << endl; cout <<"| -------------------------------------------------------------- |" << endl; cout <<"| This Program wil ask you to eneter your account number. |" << endl; cout <<"| Then it will ask for your account type Personal or Commercial. |" << endl; cout <<"| Then ask for the amount of checks you have written. |" << endl; cout <<"| Lastly it will output how much your fees are for this month. |" << endl; cout <<"| -------------------------------------------------------------- |" << endl; cout << endl; // Prolouge } int readAccNumb(){ // delarations int accNumber; // intitalizations accNumber = 0.0; // input cout << "Please Enter Account Number:"; cin >> accNumber; // Procesas // output // prolouge return accNumber; } int checksWritten (){ // Declarations int written; // Initalizations written = 0.0; // Input cout <<"Please input the amount of checks you have written this month:"; cin >> written; // Output // Prolouge return written; } char accType (){ // Declarations char answer; int numberBySwitch; // Initalizations numberBySwitch = 1; // Input while (numberBySwitch == 1){ cout << "Please Enter the acount type (C for Comerical and P for Personal):"; cin >> answer; // Process switch (answer){ case 'p': answer = 'P'; numberBySwitch += 2;break; case 'P': numberBySwitch += 2;break; case 'c': answer = 'C'; numberBySwitch += 3;break; case 'C': numberBySwitch += 3;break; default: if(numberBySwitch == 1) { cout << "Error! Please enter a correct type!" <<endl; } } } // Output // Prolouge return answer; } int commericalCalc(int checksWritten){ // Declarations int written; int checkPrice; // Initalizations checkPrice = 0.0; // Input // Process if(written < 20){ checkPrice = 0.10; } // Output // Prolouge return checkPrice; } int personalCalc(int checksWritten){ } double pricePerCheck(char accType, int checksWritten){ // Declarations double price; char answer; // Initalizations price = 0.0; // Input // Process if(accType == 'P'){ } if(accType == 'C'){ if(checksWritten < 20){ price = 0.10; } } // Output // Prolouge return price; } int main(){ // Declarations int accountNumb; char theirAccType; int writtenChecks; double split; // Initalizations accountNumb = 0.0; writtenChecks = 0.0; split = 0.0; theirAccType = ' '; // Input displayInstructions(); theirAccType = accType(); accountNumb = readAccNumb(); split = pricePerCheck(accType(), checksWritten()); // Output cout << endl; cout << "Account Type: " << theirAccType << endl; cout << "Check Price: " << split << endl; // Prolouge return 0; }

    Read the article

  • wglCreateContext in C# failing but not in managed C++

    - by SeeR
    I'm trying to use opengl in C#. I have following code which fails with error 2000 ERROR_INVALID_PIXEL_FORMAT First definitions: [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true, ExactSpelling = true)] public static extern IntPtr GetDC(IntPtr hWnd); [StructLayout(LayoutKind.Sequential)] public struct PIXELFORMATDESCRIPTOR { public void Init() { nSize = (ushort) Marshal.SizeOf(typeof (PIXELFORMATDESCRIPTOR)); nVersion = 1; dwFlags = PFD_FLAGS.PFD_DRAW_TO_WINDOW | PFD_FLAGS.PFD_SUPPORT_OPENGL | PFD_FLAGS.PFD_DOUBLEBUFFER | PFD_FLAGS.PFD_SUPPORT_COMPOSITION; iPixelType = PFD_PIXEL_TYPE.PFD_TYPE_RGBA; cColorBits = 24; cRedBits = cRedShift = cGreenBits = cGreenShift = cBlueBits = cBlueShift = 0; cAlphaBits = cAlphaShift = 0; cAccumBits = cAccumRedBits = cAccumGreenBits = cAccumBlueBits = cAccumAlphaBits = 0; cDepthBits = 32; cStencilBits = cAuxBuffers = 0; iLayerType = PFD_LAYER_TYPES.PFD_MAIN_PLANE; bReserved = 0; dwLayerMask = dwVisibleMask = dwDamageMask = 0; } ushort nSize; ushort nVersion; PFD_FLAGS dwFlags; PFD_PIXEL_TYPE iPixelType; byte cColorBits; byte cRedBits; byte cRedShift; byte cGreenBits; byte cGreenShift; byte cBlueBits; byte cBlueShift; byte cAlphaBits; byte cAlphaShift; byte cAccumBits; byte cAccumRedBits; byte cAccumGreenBits; byte cAccumBlueBits; byte cAccumAlphaBits; byte cDepthBits; byte cStencilBits; byte cAuxBuffers; PFD_LAYER_TYPES iLayerType; byte bReserved; uint dwLayerMask; uint dwVisibleMask; uint dwDamageMask; } [Flags] public enum PFD_FLAGS : uint { PFD_DOUBLEBUFFER = 0x00000001, PFD_STEREO = 0x00000002, PFD_DRAW_TO_WINDOW = 0x00000004, PFD_DRAW_TO_BITMAP = 0x00000008, PFD_SUPPORT_GDI = 0x00000010, PFD_SUPPORT_OPENGL = 0x00000020, PFD_GENERIC_FORMAT = 0x00000040, PFD_NEED_PALETTE = 0x00000080, PFD_NEED_SYSTEM_PALETTE = 0x00000100, PFD_SWAP_EXCHANGE = 0x00000200, PFD_SWAP_COPY = 0x00000400, PFD_SWAP_LAYER_BUFFERS = 0x00000800, PFD_GENERIC_ACCELERATED = 0x00001000, PFD_SUPPORT_DIRECTDRAW = 0x00002000, PFD_DIRECT3D_ACCELERATED = 0x00004000, PFD_SUPPORT_COMPOSITION = 0x00008000, PFD_DEPTH_DONTCARE = 0x20000000, PFD_DOUBLEBUFFER_DONTCARE = 0x40000000, PFD_STEREO_DONTCARE = 0x80000000 } public enum PFD_LAYER_TYPES : byte { PFD_MAIN_PLANE = 0, PFD_OVERLAY_PLANE = 1, PFD_UNDERLAY_PLANE = 255 } public enum PFD_PIXEL_TYPE : byte { PFD_TYPE_RGBA = 0, PFD_TYPE_COLORINDEX = 1 } [DllImport("gdi32.dll", CharSet = CharSet.Auto, SetLastError = true, ExactSpelling = true)] public static extern int ChoosePixelFormat(IntPtr hdc, [In] ref PIXELFORMATDESCRIPTOR ppfd); [DllImport("gdi32.dll", CharSet = CharSet.Auto, SetLastError = true, ExactSpelling = true)] public static extern bool SetPixelFormat(IntPtr hdc, int iPixelFormat, ref PIXELFORMATDESCRIPTOR ppfd); [DllImport("opengl32.dll", CharSet = CharSet.Auto, SetLastError = true, ExactSpelling = true)] public static extern IntPtr wglCreateContext(IntPtr hDC); And now the code that fails: IntPtr dc = Win.GetDC(hwnd); var pixelformatdescriptor = new GL.PIXELFORMATDESCRIPTOR(); pixelformatdescriptor.Init(); var pixelFormat = GL.ChoosePixelFormat(dc, ref pixelformatdescriptor); if(!GL.SetPixelFormat(dc, pixelFormat, ref pixelformatdescriptor)) throw new Win32Exception(Marshal.GetLastWin32Error()); IntPtr hglrc; if((hglrc = GL.wglCreateContext(dc)) == IntPtr.Zero) throw new Win32Exception(Marshal.GetLastWin32Error()); //<----- here I have exception the same code in managed C++ is working HDC dc = GetDC(hWnd); PIXELFORMATDESCRIPTOR pf; pf.nSize = sizeof(PIXELFORMATDESCRIPTOR); pf.nVersion = 1; pf.dwFlags = PFD_DRAW_TO_WINDOW | PFD_SUPPORT_OPENGL | PFD_DOUBLEBUFFER | PFD_SUPPORT_COMPOSITION; pf.cColorBits = 24; pf.cRedBits = pf.cRedShift = pf.cGreenBits = pf.cGreenShift = pf.cBlueBits = pf.cBlueShift = 0; pf.cAlphaBits = pf.cAlphaShift = 0; pf.cAccumBits = pf.cAccumRedBits = pf.cAccumGreenBits = pf.cAccumBlueBits = pf.cAccumAlphaBits = 0; pf.cDepthBits = 32; pf.cStencilBits = pf.cAuxBuffers = 0; pf.iLayerType = PFD_MAIN_PLANE; pf.bReserved = 0; pf.dwLayerMask = pf.dwVisibleMask = pf.dwDamageMask = 0; int ipf = ChoosePixelFormat(dc, &pf); SetPixelFormat(dc, ipf, &pf); HGLRC hglrc = wglCreateContext(dc); I've tried it on VIsta 64-bit with ATI graphic card and on Windows XP 32-bit with Nvidia with the same result in both cases. Also I want to mention that I don't want to use any already written framework for it. Can anyone show me where is the bug in C# code that is causing the exception?

    Read the article

  • libcurl - unable to download a file

    - by marmistrz
    I'm working on a program which will download lyrics from sites like AZLyrics. I'm using libcurl. It's my code lyricsDownloader.cpp #include "lyricsDownloader.h" #include <curl/curl.h> #include <cstring> #include <iostream> #define DEBUG 1 ///////////////////////////////////////////////////////////////////////////// size_t lyricsDownloader::write_data_to_var(char *ptr, size_t size, size_t nmemb, void *userdata) // this function is a static member function { ostringstream * stream = (ostringstream*) userdata; size_t count = size * nmemb; stream->write(ptr, count); return count; } string AZLyricsDownloader::toProviderCode() const { /*this creates an url*/ } CURLcode AZLyricsDownloader::download() { CURL * handle; CURLcode err; ostringstream buff; handle = curl_easy_init(); if (! handle) return static_cast<CURLcode>(-1); // set verbose if debug on curl_easy_setopt( handle, CURLOPT_VERBOSE, DEBUG ); curl_easy_setopt( handle, CURLOPT_URL, toProviderCode().c_str() ); // set the download url to the generated one curl_easy_setopt(handle, CURLOPT_WRITEDATA, &buff); curl_easy_setopt(handle, CURLOPT_WRITEFUNCTION, &AZLyricsDownloader::write_data_to_var); err = curl_easy_perform(handle); // The segfault should be somewhere here - after calling the function but before it ends cerr << "cleanup\n"; curl_easy_cleanup(handle); // copy the contents to text variable lyrics = buff.str(); return err; } main.cpp #include <QString> #include <QTextEdit> #include <iostream> #include "lyricsDownloader.h" int main(int argc, char *argv[]) { AZLyricsDownloader dl(argv[1], argv[2]); dl.perform(); QTextEdit qtexted(QString::fromStdString(dl.lyrics)); cout << qPrintable(qtexted.toPlainText()); return 0; } When running ./maelyrica Anthrax Madhouse I'm getting this logged from curl * About to connect() to azlyrics.com port 80 (#0) * Trying 174.142.163.250... * connected * Connected to azlyrics.com (174.142.163.250) port 80 (#0) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: azlyrics.com Accept: */* < HTTP/1.1 301 Moved Permanently < Server: nginx/1.0.12 < Date: Thu, 05 Jul 2012 16:59:21 GMT < Content-Type: text/html < Content-Length: 185 < Connection: keep-alive < Location: http://www.azlyrics.com/lyrics/anthrax/madhouse.html < Segmentation fault Strangely, the file is there. The same error is displayed when there's no such page (redirect to azlyrics.com mainpage) What am I doing wrong? Thanks in advance EDIT: I made the function for writing data static, but this changes nothing. Even wget seems to have problems $ wget http://www.azlyrics.com/lyrics/anthrax/madhouse.html --2012-07-06 10:36:05-- http://www.azlyrics.com/lyrics/anthrax/madhouse.html Resolving www.azlyrics.com... 174.142.163.250 Connecting to www.azlyrics.com|174.142.163.250|:80... connected. HTTP request sent, awaiting response... No data received. Retrying. Why does opening the page in a browser work and wget/curl not? EDIT2: After adding this: curl_easy_setopt(handle, CURLOPT_FOLLOWLOCATION, 1); The log is: * About to connect() to azlyrics.com port 80 (#0) * Trying 174.142.163.250... * connected * Connected to azlyrics.com (174.142.163.250) port 80 (#0) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: azlyrics.com Accept: */* < HTTP/1.1 301 Moved Permanently < Server: nginx/1.0.12 < Date: Fri, 06 Jul 2012 09:09:47 GMT < Content-Type: text/html < Content-Length: 185 < Connection: keep-alive < Location: http://www.azlyrics.com/lyrics/anthrax/madhouse.html < * Ignoring the response-body * Connection #0 to host azlyrics.com left intact * Issue another request to this URL: 'http://www.azlyrics.com/lyrics/anthrax/madhouse.html' * About to connect() to www.azlyrics.com port 80 (#1) * Trying 174.142.163.250... * connected * Connected to www.azlyrics.com (174.142.163.250) port 80 (#1) > GET /lyrics/anthrax/madhouse.html HTTP/1.1 Host: www.azlyrics.com Accept: */* < HTTP/1.1 200 OK < Server: nginx/1.0.12 < Date: Fri, 06 Jul 2012 09:09:47 GMT < Content-Type: text/html < Transfer-Encoding: chunked < Connection: keep-alive < Segmentation fault

    Read the article

  • .NET interview, code structure and the design

    - by j_lewis
    I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

    Read the article

  • Why can't I retrieve the entities I've just persisted?

    - by felipecao
    I've got this web service that basically queries the database and returns all persisted entities. For testing purposes, I've created a TestDataManager that persists 2 example entities after Spring context is loaded (BTW, I'm using JAX-WS, Spring, Hibernate and HSQLDB). My TestDataManager looks like this: @Component public class TestDataManager { @Resource private SessionFactory sf; @PostConstruct @Transactional(readOnly = false, propagation = Propagation.REQUIRES_NEW) public void insertTestData(){ sf.openSession(); sf.openSession().beginTransaction(); sf.openSession().persist(new Site("site one")); sf.openSession().persist(new Site("site two")); sf.openSession().flush(); } } My JAX-WS endpoint looks like this: @WebService public class SmartBrickEndpoint { @Resource private WebServiceContext context; public Set<Site> getSitesForUser(String user){ return getSiteService().findByUser(new User(user)); } private ISiteService getSiteService(){ ServletContext servletContext = (ServletContext) context.getMessageContext().get("javax.xml.ws.servlet.context"); return (ISiteService) BeanRetriever.getBean(servletContext, ISiteService.class); } } This my Service class: @Component @Transactional(readOnly = true) public class SiteService implements ISiteService { @Resource private ISiteDao siteDao; @Override public Set<Site> findByUser(User user) { return siteDao.findByUser(user); } } This is my DAO: @Component @Transactional(readOnly = true) public class SiteDao implements ISiteDao { @Resource private SessionFactory sessionFactory; @Override public Set<Site> findByUser(User user) { Set<Site> sites = new LinkedHashSet<Site>(sessionFactory.getCurrentSession().createCriteria(Site.class).list()); return sites; } } This is my applicationContext.xml: <context:annotation-config /> <context:component-scan base-package="br.unirio.wsimxp.dao"/> <context:component-scan base-package="br.unirio.wsimxp.service"/> <context:component-scan base-package="br.unirio.wsimxp.spring"/> <bean id="applicationDS" class="org.springframework.jdbc.datasource.DriverManagerDataSource"> <property name="driverClassName" value="org.hsqldb.jdbcDriver"/> <property name="url" value="jdbc:hsqldb:file:sites"/> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="applicationDS" /> <property name="configLocation"> <value>classpath:hibernate.cfg.xml</value> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.HSQLDialect</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.format_sql">true</prop> <prop key="hibernate.connection.release_mode">on_close</prop> <!--<prop key="hibernate.current_session_context_class">thread</prop>--> <prop key="hibernate.query.factory_class">org.hibernate.hql.classic.ClassicQueryTranslatorFactory</prop> <prop key="hibernate.hbm2ddl.auto">create-drop</prop> </props> </property> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory" ref="sessionFactory" /> </bean> <tx:annotation-driven transaction-manager="transactionManager" /> This is what's going on now: when the app is deployed, TestDataManager#insertTestData kicks-in (due to @PostConstruct) and persist does not raise any exception. I should have 2 entities in the DB by now. Afterwards, I invoke the endpoint by a SOAP client, and the request goes all the way up to the DAO. The Hibernate invocation does not raise any exception, but the returned list is empty. The odd thing is, in TestDataManager, if I switch from sf.openSession() to sf.getCurrentSession(), I get an error message: "No Hibernate Session bound to thread, and configuration does not allow creation of non-transactional one here". What I am doing wrong here? Why is the query "not seeing" the persisted entities? Why do I need to invoke sf.openSession() on TestDataManager although it's annotated with @Transactional? I have done some tests with hibernate.current_session_context_class=thread in application.xml, but then I just switch problems in each class. I'd like not needing to manually invoke sf.openSession() and leave that for Hibernate to take care. Thanks a lot for any help!

    Read the article

< Previous Page | 831 832 833 834 835 836 837 838 839 840 841 842  | Next Page >